Ursus americanus (American black bear): 123776933 Help Entry 123776933         CDS       T07931                                  Symbol CCL5 Name (RefSeq) C-C motif chemokine 5   KO K12499   C-C motif chemokine 5 Organism uar  Ursus americanus (American black bear) Pathway uar04060   Cytokine-cytokine receptor interaction uar04061   Viral protein interaction with cytokine and cytokine receptor uar04062   Chemokine signaling pathway uar04620   Toll-like receptor signaling pathway uar04621   NOD-like receptor signaling pathway uar04623   Cytosolic DNA-sensing pathway uar04668   TNF signaling pathway uar05020   Prion disease uar05142   Chagas disease uar05163   Human cytomegalovirus infection uar05164   Influenza A uar05168   Herpes simplex virus 1 infection uar05323   Rheumatoid arthritis uar05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:uar00001]  09130 Environmental Information Processing   09132 Signal transduction    04668 TNF signaling pathway     123776933 (CCL5)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     123776933 (CCL5)    04061 Viral protein interaction with cytokine and cytokine receptor     123776933 (CCL5)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     123776933 (CCL5)    04621 NOD-like receptor signaling pathway     123776933 (CCL5)    04623 Cytosolic DNA-sensing pathway     123776933 (CCL5)    04062 Chemokine signaling pathway     123776933 (CCL5)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     123776933 (CCL5)    05168 Herpes simplex virus 1 infection     123776933 (CCL5)    05163 Human cytomegalovirus infection     123776933 (CCL5)   09174 Infectious disease: parasitic    05142 Chagas disease     123776933 (CCL5)   09163 Immune disease    05323 Rheumatoid arthritis     123776933 (CCL5)   09164 Neurodegenerative disease    05020 Prion disease     123776933 (CCL5)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     123776933 (CCL5)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:uar04052]     123776933 (CCL5)    00536 Glycosaminoglycan binding proteins [BR:uar00536]     123776933 (CCL5) Cytokines and neuropeptides [BR:uar04052]  Cytokines   Chemokines    123776933 (CCL5) Glycosaminoglycan binding proteins [BR:uar00536]  Heparan sulfate / Heparin   Chemokines    123776933 (CCL5) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Ig_NUP210_1st CXCL16 Motif Other DBs NCBI-GeneID:  123776933 NCBI-ProteinID:  XP_045629264 LinkDB All DBs Position Unknown AA seq 91 aa AA seqDB search MKVSAATFAVLLATAAFCAPASASPYASDTTPCCFAYISRRLPFTHIQEYFYTSSKCSMP AVVFVTRKHRQVCADPQKKWVRDHINSLEMS NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgaaggtctccgcagccacctttgcggtcctcctcgccactgccgccttctgcgctcct gcctctgcctccccatatgcctcggacaccacaccctgctgctttgcctacatctcccgc cgactgcccttcacccacatccaggagtatttctacaccagcagcaagtgctccatgcca gcggtcgtctttgtcacccgaaagcaccgccaggtgtgtgccgatccacagaagaaatgg gtgcgggaccacatcaactctttggagatgagttag

DBGET integrated database retrieval system