Ursus americanus (American black bear): 123776969 Help Entry 123776969         CDS       T07931                                  Name (RefSeq) C-C motif chemokine 3   KO K05408   C-C motif chemokine 3 Organism uar  Ursus americanus (American black bear) Pathway uar04060   Cytokine-cytokine receptor interaction uar04061   Viral protein interaction with cytokine and cytokine receptor uar04062   Chemokine signaling pathway uar04620   Toll-like receptor signaling pathway uar05142   Chagas disease uar05163   Human cytomegalovirus infection uar05323   Rheumatoid arthritis uar05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:uar00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     123776969    04061 Viral protein interaction with cytokine and cytokine receptor     123776969  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     123776969    04062 Chemokine signaling pathway     123776969  09160 Human Diseases   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     123776969   09174 Infectious disease: parasitic    05142 Chagas disease     123776969   09163 Immune disease    05323 Rheumatoid arthritis     123776969   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     123776969  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:uar04052]     123776969    00536 Glycosaminoglycan binding proteins [BR:uar00536]     123776969 Cytokines and neuropeptides [BR:uar04052]  Cytokines   Chemokines    123776969 Glycosaminoglycan binding proteins [BR:uar00536]  Heparan sulfate / Heparin   Chemokines    123776969 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  123776969 NCBI-ProteinID:  XP_045629318 UniProt:  A0A452R1I5 LinkDB All DBs Position Unknown AA seq 93 aa AA seqDB search MKVPGAVLAVLLCTMALCSQVFSAPFGADTPTACCFSYVSKPIPRKFIVDYFETSSQCSK PGVIFQTRKGRQACADPSEAWVQEYVTDLELNA NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgaaggtccccggggctgtgctcgccgtcctcctctgcaccatggccctctgcagccag gtcttctctgcaccatttggtgctgacaccccaaccgcctgctgcttctcctacgtctcc aagccgattccacgcaagttcatagtcgactattttgagaccagcagccaatgctccaag cctggtgttatcttccagaccagaaaaggccgccaggcctgtgccgaccccagtgaggcc tgggtccaggagtacgtgaccgacctggagctgaatgcctga

DBGET integrated database retrieval system