Ursus americanus (American black bear): 123776974 Help Entry 123776974         CDS       T07931                                  Name (RefSeq) C-C motif chemokine 4   KO K12964   C-C motif chemokine 4 Organism uar  Ursus americanus (American black bear) Pathway uar04060   Cytokine-cytokine receptor interaction uar04061   Viral protein interaction with cytokine and cytokine receptor uar04062   Chemokine signaling pathway uar04064   NF-kappa B signaling pathway uar04620   Toll-like receptor signaling pathway uar04623   Cytosolic DNA-sensing pathway uar05163   Human cytomegalovirus infection Brite KEGG Orthology (KO) [BR:uar00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     123776974   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     123776974    04061 Viral protein interaction with cytokine and cytokine receptor     123776974  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     123776974    04623 Cytosolic DNA-sensing pathway     123776974    04062 Chemokine signaling pathway     123776974  09160 Human Diseases   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     123776974  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:uar04052]     123776974 Cytokines and neuropeptides [BR:uar04052]  Cytokines   Chemokines    123776974 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  123776974 NCBI-ProteinID:  XP_045629321 UniProt:  A0A452R1G8 LinkDB All DBs Position Unknown AA seq 92 aa AA seqDB search MKLCATVLSLLVLVAAFYSPALSAPMGSDPPTACCFSYTLRKLPRNFVTDYFETSSLCSQ PAVVFQTKRGRQVCANPSEAWVQEYMDDLELN NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgaagctctgtgcgaccgtcctttctctcctcgtgctagtggctgccttctactcccca gcgctctcagcaccaatgggctcagaccctcccaccgcctgctgcttctcttacaccctt cggaagctccctcgcaactttgtgaccgactacttcgagaccagcagcctctgctcccag ccagccgtggtattccaaaccaaaaggggcagacaagtgtgtgctaaccccagtgaggcc tgggtccaggaatacatggatgacctggaactgaactga

DBGET integrated database retrieval system