Ursus americanus (American black bear): 123777317 Help Entry 123777317         CDS       T07931                                  Symbol MYL10 Name (RefSeq) myosin regulatory light chain 10   KO K12756   myosin regulatory light chain 10 Organism uar  Ursus americanus (American black bear) Pathway uar04510   Focal adhesion uar04520   Adherens junction uar04670   Leukocyte transendothelial migration uar04810   Regulation of actin cytoskeleton uar04814   Motor proteins uar05132   Salmonella infection Brite KEGG Orthology (KO) [BR:uar00001]  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     123777317 (MYL10)    04520 Adherens junction     123777317 (MYL10)   09142 Cell motility    04814 Motor proteins     123777317 (MYL10)    04810 Regulation of actin cytoskeleton     123777317 (MYL10)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     123777317 (MYL10)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     123777317 (MYL10)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:uar04812]     123777317 (MYL10) Cytoskeleton proteins [BR:uar04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Myosins      123777317 (MYL10) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_6 EF-hand_1 EF-hand_8 EF-hand_5 SAPC2_N EF_EFCAB10_C EF-hand_FSTL1 AIF-1 Motif Other DBs NCBI-GeneID:  123777317 NCBI-ProteinID:  XP_045629838 LinkDB All DBs Position Unknown AA seq 147 aa AA seqDB search MFDQSQIQEFKEAFTIMDQNRDGFIDKEDLRDTFAALGRINVKNEELEAMVKEAPGPINF TVFLTMFGEKLKGTDPEETILHAFKVFDTEGKGFVKADFIKEKLMTQADRFSEDEVKQMF AAFPPDVCGNLDYRNLCYVITHGEEKD NT seq 444 nt NT seq  +upstreamnt  +downstreamnt atgttcgatcagtcccagatccaggagtttaaagaggccttcaccatcatggaccagaac cgggatggcttcatcgacaaggaggacctgcgggacacctttgctgccttgggccgcatc aatgtgaagaacgaggagctggaggccatggtgaaggaggcccctgggcccatcaacttc accgttttcctgaccatgtttggggagaagctgaagggtacagacccggaggagaccatt ctccacgccttcaaggtctttgacaccgaagggaaaggctttgtcaaggctgatttcatc aaagagaagctcatgacccaggcagaccggttcagtgaggacgaggtcaagcagatgttt gcggctttcccgccagatgtgtgtggcaacctggattaccggaacctatgctacgtcatc acgcacggagaagagaaggactag

DBGET integrated database retrieval system