Ursus americanus (American black bear): 123778453 Help Entry 123778453         CDS       T07931                                  Symbol CFL1 Name (RefSeq) cofilin-1   KO K05765   cofilin Organism uar  Ursus americanus (American black bear) Pathway uar04360   Axon guidance uar04666   Fc gamma R-mediated phagocytosis uar04810   Regulation of actin cytoskeleton uar05133   Pertussis uar05170   Human immunodeficiency virus 1 infection Brite KEGG Orthology (KO) [BR:uar00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     123778453 (CFL1)  09150 Organismal Systems   09151 Immune system    04666 Fc gamma R-mediated phagocytosis     123778453 (CFL1)   09158 Development and regeneration    04360 Axon guidance     123778453 (CFL1)  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     123778453 (CFL1)   09171 Infectious disease: bacterial    05133 Pertussis     123778453 (CFL1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:uar04131]     123778453 (CFL1)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:uar04812]     123778453 (CFL1)    04147 Exosome [BR:uar04147]     123778453 (CFL1) Membrane trafficking [BR:uar04131]  Others   Actin-binding proteins    Others     123778453 (CFL1) Cytoskeleton proteins [BR:uar04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     ADF / Cofilin      123778453 (CFL1) Exosome [BR:uar04147]  Exosomal proteins   Proteins found in most exosomes    123778453 (CFL1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Cofilin_ADF Motif Other DBs NCBI-GeneID:  123778453 NCBI-ProteinID:  XP_045631776 LinkDB All DBs Position Unknown AA seq 166 aa AA seqDB search MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDV GQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASS KDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL NT seq 501 nt NT seq  +upstreamnt  +downstreamnt atggcctccggcgtggcagtctctgatggcgtcatcaaagtgttcaatgacatgaaggtg cgtaagtcctcgacaccagaggaggtgaagaagcgcaagaaggcggtacttttctgcctg agcgaggataagaagaacatcatcctggaggagggcaaggagatcctggtaggtgatgtg ggccagactgtagacgacccctacgccacctttgtcaagatgctgccggacaaggactgc cgctacgccctctacgacgcaacctatgagaccaaggagagcaagaaggaggacttggtg tttatcttctgggcacctgagtctgcaccccttaagagcaaaatgatttatgccagctcc aaggatgccatcaagaaaaagctgacggggatcaagcatgaattacaagcaaactgctac gaggaggtcaaggaccgctgcaccctggcagagaaactggggggcagtgctgtcatctcc ctggagggcaagcctttgtga

DBGET integrated database retrieval system