Ursus americanus (American black bear): 123779217 Help Entry 123779217         CDS       T07931                                  Name (RefSeq) histone H4   KO K11254   histone H4 Organism uar  Ursus americanus (American black bear) Pathway uar04613   Neutrophil extracellular trap formation uar05034   Alcoholism uar05203   Viral carcinogenesis uar05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:uar00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     123779217  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     123779217   09163 Immune disease    05322 Systemic lupus erythematosus     123779217   09165 Substance dependence    05034 Alcoholism     123779217  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:uar03036]     123779217 Chromosome and associated proteins [BR:uar03036]  Eukaryotic type   Nucleosome assembly factors    Histones     123779217 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137 Motif Other DBs NCBI-GeneID:  123779217 NCBI-ProteinID:  XP_045633101 LinkDB All DBs Position Unknown AA seq 103 aa AA seqDB search MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtcgggaaggggaaaaggcggtaagggtttaggcaagggtggtgctaagcgccaccgc aaggtcttgagagataacatccaaggtattactaaaccggcgatccggcgccttgctcgg cgtgggggagtcaagcggatctccggcctcatctacgaggagacccggggtgtgctaaag gtgttcctagagaacgtcattcgggacgcagtcacctacaccgagcacgctaagcgcaag acggtcactgctatggatgtggtgtatgccctcaagcggcagggacgcaccctgtatggc ttcggaggctaa

DBGET integrated database retrieval system