Ursus americanus (American black bear): 123779223 Help Entry 123779223         CDS       T07931                                  Name (RefSeq) histone H3   KO K11253   histone H3 Organism uar  Ursus americanus (American black bear) Pathway uar04613   Neutrophil extracellular trap formation uar05034   Alcoholism uar05202   Transcriptional misregulation in cancer uar05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:uar00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     123779223  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     123779223   09163 Immune disease    05322 Systemic lupus erythematosus     123779223   09165 Substance dependence    05034 Alcoholism     123779223  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:uar03036]     123779223   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:uar04147]     123779223 Chromosome and associated proteins [BR:uar03036]  Eukaryotic type   Nucleosome assembly factors    Histones     123779223 Exosome [BR:uar04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    123779223 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF YebU_pre-PUA_dom TFIID-31kDa Motif Other DBs NCBI-GeneID:  123779223 NCBI-ProteinID:  XP_045633105 UniProt:  A0A452SA57 LinkDB All DBs Position Unknown AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgcacaaagcagaccgcccgcaagtcgaccggtggcaaggccccgcgcaagcag ctggccaccaaggcggcccgcaagagcgcgccggccacgggcggcgtgaagaagccgcac cgttaccggccgggcaccgtggccctgcgggagatccggcgctaccagaagtccaccgag ctgttgatccgcaagctgccgttccagcggctggtgcgcgagatcgcgcaggacttcaag acggacctgcgcttccagagctcggccgtgatggcgctgcaggaggcgagcgaggcctac ctggtggggctgttcgaggacacgaacctgtgcgccatccacgccaagcgtgtcaccatc atgccgaaggacatccagctggctcgccgcatccgcggggagcgggcttaa

DBGET integrated database retrieval system