Ursus americanus (American black bear): 123779922 Help Entry 123779922         CDS       T07931                                  Name (RefSeq) protein S100-A10-like   KO K17274   protein S100-A10 Organism uar  Ursus americanus (American black bear) Pathway uar04382   Cornified envelope formation uar05132   Salmonella infection Brite KEGG Orthology (KO) [BR:uar00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     123779922  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     123779922  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:uar04147]     123779922 Exosome [BR:uar04147]  Exosomal proteins   Exosomal proteins of microglial cells    123779922 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EFhand_Ca_insen EF-hand_6 EF-hand_8 Motif Other DBs NCBI-GeneID:  123779922 NCBI-ProteinID:  XP_045634574 UniProt:  A0A452QB07 LinkDB All DBs Position Unknown AA seq 97 aa AA seqDB search MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKGPLAVDKIMKDLD QCRDGRVGFQSFFSLIAGLTIACNDYFVIHMKQKGKK NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgccgtctcaaatggaacatgccatggaaaccatgatgttcacgtttcacaagtttgct ggggataaaggctacttaacaaaggaggacctgagagtgctcatggaaaaggagttccct ggatttttggaaaatcaaaaaggccctctggccgtggacaaaataatgaaggacctagac cagtgccgagacggcagagtgggctttcagagcttcttctcgctaatcgccgggctcacc atcgcgtgcaatgactattttgtaatacacatgaagcagaagggaaagaagtag

DBGET integrated database retrieval system