Ursus americanus (American black bear): 123780463 Help Entry 123780463         CDS       T07931                                  Name (RefSeq) late histone H2B.L4-like   KO K11252   histone H2B Organism uar  Ursus americanus (American black bear) Pathway uar04613   Neutrophil extracellular trap formation uar05034   Alcoholism uar05203   Viral carcinogenesis uar05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:uar00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     123780463  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     123780463   09163 Immune disease    05322 Systemic lupus erythematosus     123780463   09165 Substance dependence    05034 Alcoholism     123780463  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:uar03036]     123780463   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:uar04147]     123780463 Chromosome and associated proteins [BR:uar03036]  Eukaryotic type   Nucleosome assembly factors    Histones     123780463 Exosome [BR:uar04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    123780463 SSDB OrthologParalogGFIT Motif Pfam:  Histone Histone_ABTB CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  123780463 NCBI-ProteinID:  XP_045635346 LinkDB All DBs Position Unknown AA seq 140 aa AA seqDB search MAEPGCEPSSEESLGTEEPSAADPKSPKQKQPRRQCRGHRHIRCPDSFATYFPRVLKQVH EGLSLSKKAVSVMDSFVKDIFERIADEAARLARSTKGSNKHSTISSREIQTAVRLLLPGE IGKHAVSEATKAIIRYTLCQ NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggctgagcctggctgtgagccctcttctgaggaaagcctgggcacggaggagccgtcg gcagccgacccaaagagcccgaagcaaaagcagccgaggcgccagtgccgcggccaccgc cacatccgctgccccgacagtttcgccacctacttccccagggttctgaagcaggtgcac gagggcctgagcctctcgaagaaggccgtgagcgtcatggattcgttcgttaaggacatc ttcgagcgcatcgccgacgaggccgctcgtctggctcgctccaccaagggctccaacaag cactccaccatcagctccagggagatccagacagccgtgcgcctgctgctgcccggggag atcggcaagcacgccgtgtccgaggccaccaaggccatcatcaggtacaccttatgccaa tga

DBGET integrated database retrieval system