Ursus americanus (American black bear): 123781022 Help Entry 123781022         CDS       T07931                                  Symbol PPP3R2 Name (RefSeq) calcineurin subunit B type 2   KO K06268   serine/threonine-protein phosphatase 2B regulatory subunit Organism uar  Ursus americanus (American black bear) Pathway uar04010   MAPK signaling pathway uar04020   Calcium signaling pathway uar04022   cGMP-PKG signaling pathway uar04114   Oocyte meiosis uar04218   Cellular senescence uar04310   Wnt signaling pathway uar04360   Axon guidance uar04370   VEGF signaling pathway uar04380   Osteoclast differentiation uar04625   C-type lectin receptor signaling pathway uar04650   Natural killer cell mediated cytotoxicity uar04658   Th1 and Th2 cell differentiation uar04659   Th17 cell differentiation uar04660   T cell receptor signaling pathway uar04662   B cell receptor signaling pathway uar04720   Long-term potentiation uar04724   Glutamatergic synapse uar04921   Oxytocin signaling pathway uar04922   Glucagon signaling pathway uar04924   Renin secretion uar05010   Alzheimer disease uar05014   Amyotrophic lateral sclerosis uar05020   Prion disease uar05022   Pathways of neurodegeneration - multiple diseases uar05031   Amphetamine addiction uar05152   Tuberculosis uar05163   Human cytomegalovirus infection uar05166   Human T-cell leukemia virus 1 infection uar05167   Kaposi sarcoma-associated herpesvirus infection uar05170   Human immunodeficiency virus 1 infection uar05235   PD-L1 expression and PD-1 checkpoint pathway in cancer uar05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:uar00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     123781022 (PPP3R2)    04310 Wnt signaling pathway     123781022 (PPP3R2)    04370 VEGF signaling pathway     123781022 (PPP3R2)    04020 Calcium signaling pathway     123781022 (PPP3R2)    04022 cGMP-PKG signaling pathway     123781022 (PPP3R2)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     123781022 (PPP3R2)    04218 Cellular senescence     123781022 (PPP3R2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     123781022 (PPP3R2)    04650 Natural killer cell mediated cytotoxicity     123781022 (PPP3R2)    04660 T cell receptor signaling pathway     123781022 (PPP3R2)    04658 Th1 and Th2 cell differentiation     123781022 (PPP3R2)    04659 Th17 cell differentiation     123781022 (PPP3R2)    04662 B cell receptor signaling pathway     123781022 (PPP3R2)   09152 Endocrine system    04922 Glucagon signaling pathway     123781022 (PPP3R2)    04921 Oxytocin signaling pathway     123781022 (PPP3R2)    04924 Renin secretion     123781022 (PPP3R2)   09156 Nervous system    04724 Glutamatergic synapse     123781022 (PPP3R2)    04720 Long-term potentiation     123781022 (PPP3R2)   09158 Development and regeneration    04360 Axon guidance     123781022 (PPP3R2)    04380 Osteoclast differentiation     123781022 (PPP3R2)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     123781022 (PPP3R2)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     123781022 (PPP3R2)    05170 Human immunodeficiency virus 1 infection     123781022 (PPP3R2)    05163 Human cytomegalovirus infection     123781022 (PPP3R2)    05167 Kaposi sarcoma-associated herpesvirus infection     123781022 (PPP3R2)   09171 Infectious disease: bacterial    05152 Tuberculosis     123781022 (PPP3R2)   09164 Neurodegenerative disease    05010 Alzheimer disease     123781022 (PPP3R2)    05014 Amyotrophic lateral sclerosis     123781022 (PPP3R2)    05020 Prion disease     123781022 (PPP3R2)    05022 Pathways of neurodegeneration - multiple diseases     123781022 (PPP3R2)   09165 Substance dependence    05031 Amphetamine addiction     123781022 (PPP3R2)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     123781022 (PPP3R2)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:uar01009]     123781022 (PPP3R2) Protein phosphatases and associated proteins [BR:uar01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      123781022 (PPP3R2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg EH EF-hand_9 YtfJ_HI0045 DUF6967 Motif Other DBs NCBI-GeneID:  123781022 NCBI-ProteinID:  XP_045636235 LinkDB All DBs Position Unknown AA seq 170 aa AA seqDB search MGNEASYPEEMCSHFNSDEIKRLGKRFKKLDLDSSGALSLEEFMSLPELQQNPLVQRVVD VFDTDGNGEVDFKEFILGTSQFSVRGDEEQKLRFAFSIYDIDKDGYISNGELFQVLKLMV GNNLKDWQLQQLVDKTIIILDQDGDGKISFEEFCTVVGGLEIHKKLVVIV NT seq 513 nt NT seq  +upstreamnt  +downstreamnt atgggaaatgaagccagttacccggaggaaatgtgctcccacttcaactctgacgaaatc aaaaggctgggcaagaggtttaagaagctggacttggactcttcgggcgcactgagcctg gaggagttcatgtccctgcccgagctgcagcagaatccgttggtgcagcgagtggtcgac gtcttcgacaccgacggcaacggagaagtggacttcaaggagttcatcctggggacctcc cagttcagcgtcaggggggacgaggagcaaaagttgaggtttgccttcagcatctacgac atcgataaagacggctacatttccaacggggagctcttccaggtgctgaagctgatggtg ggcaacaacctgaaggactggcagctgcagcagctcgtggacaaaaccatcatcatcctg gaccaggatggagacggcaaaatatccttcgaggaattctgcactgtggtcggaggcctg gagatccacaagaagttggtggtgatagtgtga

DBGET integrated database retrieval system