Ursus americanus (American black bear): 123781256 Help Entry 123781256         CDS       T07931                                  Name (RefSeq) interferon alpha-1/2-like   KO K05414   interferon alpha Organism uar  Ursus americanus (American black bear) Pathway uar04060   Cytokine-cytokine receptor interaction uar04151   PI3K-Akt signaling pathway uar04217   Necroptosis uar04620   Toll-like receptor signaling pathway uar04621   NOD-like receptor signaling pathway uar04622   RIG-I-like receptor signaling pathway uar04623   Cytosolic DNA-sensing pathway uar04630   JAK-STAT signaling pathway uar04650   Natural killer cell mediated cytotoxicity uar04936   Alcoholic liver disease uar05152   Tuberculosis uar05160   Hepatitis C uar05161   Hepatitis B uar05162   Measles uar05163   Human cytomegalovirus infection uar05164   Influenza A uar05165   Human papillomavirus infection uar05167   Kaposi sarcoma-associated herpesvirus infection uar05168   Herpes simplex virus 1 infection uar05169   Epstein-Barr virus infection uar05170   Human immunodeficiency virus 1 infection uar05171   Coronavirus disease - COVID-19 uar05200   Pathways in cancer uar05320   Autoimmune thyroid disease uar05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:uar00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     123781256    04151 PI3K-Akt signaling pathway     123781256   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     123781256  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     123781256  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     123781256    04621 NOD-like receptor signaling pathway     123781256    04622 RIG-I-like receptor signaling pathway     123781256    04623 Cytosolic DNA-sensing pathway     123781256    04650 Natural killer cell mediated cytotoxicity     123781256  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     123781256   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     123781256    05161 Hepatitis B     123781256    05160 Hepatitis C     123781256    05171 Coronavirus disease - COVID-19     123781256    05164 Influenza A     123781256    05162 Measles     123781256    05168 Herpes simplex virus 1 infection     123781256    05163 Human cytomegalovirus infection     123781256    05167 Kaposi sarcoma-associated herpesvirus infection     123781256    05169 Epstein-Barr virus infection     123781256    05165 Human papillomavirus infection     123781256   09171 Infectious disease: bacterial    05152 Tuberculosis     123781256   09163 Immune disease    05320 Autoimmune thyroid disease     123781256   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     123781256   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     123781256  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:uar04052]     123781256 Cytokines and neuropeptides [BR:uar04052]  Cytokines   Interferons    123781256 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  123781256 NCBI-ProteinID:  XP_045636612 LinkDB All DBs Position Unknown AA seq 187 aa AA seqDB search MALPFSFLVALVVLSGNSLCSLGCDLPQNHGLFAWRALTLLGQMKRMSASSCDGYTRDFA FPKEVVDGKQLQKAQAFSVVYVMNQKIFHVFCTEASSAAWNTTLLEEFCSGLSEQLSVLE ACPMQAAGLGETPGMNVDSILRNYFQRISLYLQEKQYSPCAWETVRAEITSSLFSSTILQ EGLRRKK NT seq 564 nt NT seq  +upstreamnt  +downstreamnt atggccctgcccttctccttcttggtggccctggtggtgctcagcggcaactccctctgc tctctgggctgtgacctgcctcagaaccatggcctgtttgcctggagggccttgacgctc ctgggacaaatgaagagaatgtctgctagctcttgtgacgggtacacacgtgactttgcc ttccccaaggaggtggttgatggtaagcagttgcagaaggctcaagccttctcggtcgtt tatgtgatgaaccagaagatcttccacgtcttctgcacagaggcctcatctgctgcttgg aacacgaccctcctagaggaattctgctcgggactttctgagcagctgagcgtcctggaa gcctgtcccatgcaggcggcgggattgggagagactcccggcatgaatgtggactccatc ctgaggaactacttccaaagaatctccctctacctgcaagagaagcaatacagcccttgt gcctgggagactgtcagagcagaaatcacgagctccttgttttcttcaacgatcttgcaa gaaggactaaggcgcaagaaatga

DBGET integrated database retrieval system