Ursus americanus (American black bear): 123781827 Help Entry 123781827         CDS       T07931                                  Symbol GAST Name (RefSeq) gastrin   KO K13768   gastrin Organism uar  Ursus americanus (American black bear) Pathway uar04081   Hormone signaling uar04971   Gastric acid secretion Brite KEGG Orthology (KO) [BR:uar00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04081 Hormone signaling     123781827 (GAST)  09150 Organismal Systems   09154 Digestive system    04971 Gastric acid secretion     123781827 (GAST)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:uar04052]     123781827 (GAST) Cytokines and neuropeptides [BR:uar04052]  Neuropeptides   GPCR binding    123781827 (GAST) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Gastrin PsbT Motif Other DBs NCBI-GeneID:  123781827 NCBI-ProteinID:  XP_045637522 UniProt:  A0A452SI35 LinkDB All DBs Position Unknown AA seq 104 aa AA seqDB search MQRLCVYVLVLALALATFSEASWKPHSQLQDAPSGAGANRGLEPHWLDRLGAAPHQRRQL GLQGPPQPVADLSKKQGPWLEEEEAAYGWMDFGRRSAEEGDRRP NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgcagcgactgtgtgtgtacgtgctggtcctggcactggctctggccaccttctctgaa gcttcttggaagccccactcccagctgcaggatgcaccctcgggtgcaggggcaaatagg ggcctggagccacactggctggaccggctgggcgcagcccctcaccagcgaaggcagcta gggctccagggtcccccacagccggtggcagacctgtccaagaagcagggaccgtggctg gaggaggaagaagcagcatatggatggatggacttcggccgccgcagcgctgaggaaggg gaccgacgtccctag

DBGET integrated database retrieval system