Ursus americanus (American black bear): 123784736 Help Entry 123784736         CDS       T07931                                  Symbol CLDN4 Name (RefSeq) claudin-4   KO K06087   claudin Organism uar  Ursus americanus (American black bear) Pathway uar03272   Virion - Hepatitis viruses uar04382   Cornified envelope formation uar04514   Cell adhesion molecule (CAM) interaction uar04530   Tight junction uar04670   Leukocyte transendothelial migration uar05160   Hepatitis C Brite KEGG Orthology (KO) [BR:uar00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     123784736 (CLDN4)  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecule (CAM) interaction     123784736 (CLDN4)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     123784736 (CLDN4)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     123784736 (CLDN4)   09158 Development and regeneration    04382 Cornified envelope formation     123784736 (CLDN4)  09160 Human Diseases   09172 Infectious disease: viral    05160 Hepatitis C     123784736 (CLDN4)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:uar03037]     123784736 (CLDN4)    04147 Exosome [BR:uar04147]     123784736 (CLDN4) Cilium and associated proteins [BR:uar03037]  Other cilia and associated proteins   Stereociliary proteins    123784736 (CLDN4) Exosome [BR:uar04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    123784736 (CLDN4)   Exosomal proteins of colorectal cancer cells    123784736 (CLDN4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PMP22_Claudin Claudin_2 TMEM37 CdpA_N Motif Other DBs NCBI-GeneID:  123784736 NCBI-ProteinID:  XP_045642142 UniProt:  A0A452QUZ7 LinkDB All DBs Position Unknown AA seq 209 aa AA seqDB search MASMGLQVMGIALAVLGWLGAILSCALPMWRVTAFIGSNIVTSQTIWEGLWMNCVVQSTG QMQCKVYDSLLALPQDLQAARALMVICIIVAVLGVLLSVVGGKCTNCVEDESAKAKTMIV AGVVFLLAGLLVMVPASWTANTIIRDFYNPLVASGQKREMGASLYIGWAASGLLLLGGAL LCCNCPPRTDKPYSAKYSAARSAPASNYV NT seq 630 nt NT seq  +upstreamnt  +downstreamnt atggcctccatggggctgcaggtgatggggatcgcgctggccgtgctgggctggctgggc gccatcctgagctgcgcgctgcccatgtggcgcgtgacggccttcatcggcagcaacatc gtcacgtcgcagaccatctgggagggcctgtggatgaactgcgtggtgcagagcaccggc cagatgcagtgcaaggtgtacgactcgctgctggccctgccgcaggacctgcaggcggcc cgggccctcatggtcatctgcatcatcgtggccgtgctgggcgtgctgctgtcggtggtg ggtggcaagtgcaccaactgcgtggaggacgagagcgccaaggccaagaccatgattgtg gcaggcgtggtgttcctgctagccggcctgctggtcatggtgccggcgtcctggacggcc aacaccatcatccgggacttctacaacccgctggtggcctccggccagaagcgggagatg ggcgcctctctctacatcggctgggccgcctcgggcctgctgctgctcgggggggccctt ctctgctgcaactgcccaccccgcaccgacaagccctactcggccaagtactcggccgct cgctccgccccagccagcaactacgtgtaa

DBGET integrated database retrieval system