Ursus americanus (American black bear): 123784784 Help Entry 123784784         CDS       T07931                                  Symbol CCL24 Name (RefSeq) C-C motif chemokine 24   KO K21097   C-C motif chemokine 24 Organism uar  Ursus americanus (American black bear) Pathway uar04060   Cytokine-cytokine receptor interaction uar04061   Viral protein interaction with cytokine and cytokine receptor uar04062   Chemokine signaling pathway Brite KEGG Orthology (KO) [BR:uar00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     123784784 (CCL24)    04061 Viral protein interaction with cytokine and cytokine receptor     123784784 (CCL24)  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     123784784 (CCL24)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:uar04052]     123784784 (CCL24) Cytokines and neuropeptides [BR:uar04052]  Cytokines   Chemokines    123784784 (CCL24) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  123784784 NCBI-ProteinID:  XP_045642228 UniProt:  A0A452QBR3 LinkDB All DBs Position Unknown AA seq 119 aa AA seqDB search MAGLATLGASLLLLTLCAHHLDPAGSVSIPSSCCMSFISKTVPEKRVASYQLSSASVCPM AGVIFTTRKGQKFCGDPKQPWVQKITKLVDARRKKASPTVRAMSTKAPVQGSPANTTSI NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggcaggccttgcgacccttggggctagcctcctgctcctgaccctgtgtgcccaccac cttgaccctgcaggctctgtgtccatcccctcttcctgctgcatgtccttcatttccaag acagttcccgagaagcgagtggctagctaccagctgtccagtgcgagcgtctgccctatg gcaggagtgatcttcaccaccaggaagggccagaagttctgtggcgaccccaagcagccc tgggtccagaagatcacgaagctggtggatgccaggcggaagaaggcatcccctactgtc agggcaatgagcaccaaagcccctgtgcaggggagccctgccaacaccacctccatctaa

DBGET integrated database retrieval system