Ursus americanus (American black bear): 123786941 Help Entry 123786941         CDS       T07931                                  Symbol IL11 Name (RefSeq) interleukin-11   KO K05417   interleukin 11 Organism uar  Ursus americanus (American black bear) Pathway uar04060   Cytokine-cytokine receptor interaction uar04630   JAK-STAT signaling pathway uar04640   Hematopoietic cell lineage uar05323   Rheumatoid arthritis Brite KEGG Orthology (KO) [BR:uar00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     123786941 (IL11)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     123786941 (IL11)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     123786941 (IL11)  09160 Human Diseases   09163 Immune disease    05323 Rheumatoid arthritis     123786941 (IL11)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:uar04052]     123786941 (IL11) Cytokines and neuropeptides [BR:uar04052]  Cytokines   Interleukins    123786941 (IL11) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL11 Motif Other DBs NCBI-GeneID:  123786941 NCBI-ProteinID:  XP_045645248 LinkDB All DBs Position Unknown AA seq 120 aa AA seqDB search MSAGALGALQLPGVLTRLRADLFSYLRHVQWLRRAGGPSLRTLEPELGALQARLDRLLRR LQLLMSRLALPQAPPDPPAPPLAPPASAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL NT seq 363 nt NT seq  +upstreamnt  +downstreamnt atgagtgcaggggcgctgggagccctacaactcccaggtgtgctgacacggctgcgagcc gacctgttctcctacctgcgccatgtacagtggctgcgccgagcggggggcccttccctg cggaccctggagccggagctgggtgccctgcaggcccggctggaccgcctgctgcgccgg ctgcagctcctgatgtcccgcctggccttaccccaagcacccccagacccaccagctccc ccgctggcccccccggcctctgcctggggaggcatcagggcagcccatgccattcttggg gggctgcacctgacccttgactgggccgtgcggggcttgctgctgctgaagactcggctg tga

DBGET integrated database retrieval system