Ursus americanus (American black bear): 123787269 Help Entry 123787269         CDS       T07931                                  Symbol RAB5B Name (RefSeq) ras-related protein Rab-5B   KO K07888   Ras-related protein Rab-5B Organism uar  Ursus americanus (American black bear) Pathway uar04014   Ras signaling pathway uar04137   Mitophagy - animal uar04144   Endocytosis uar04145   Phagosome uar04148   Efferocytosis uar04962   Vasopressin-regulated water reabsorption uar05132   Salmonella infection uar05146   Amoebiasis uar05152   Tuberculosis Brite KEGG Orthology (KO) [BR:uar00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     123787269 (RAB5B)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     123787269 (RAB5B)    04145 Phagosome     123787269 (RAB5B)    04137 Mitophagy - animal     123787269 (RAB5B)    04148 Efferocytosis     123787269 (RAB5B)  09150 Organismal Systems   09155 Excretory system    04962 Vasopressin-regulated water reabsorption     123787269 (RAB5B)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     123787269 (RAB5B)    05152 Tuberculosis     123787269 (RAB5B)   09174 Infectious disease: parasitic    05146 Amoebiasis     123787269 (RAB5B)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:uar04131]     123787269 (RAB5B)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:uar04147]     123787269 (RAB5B)    04031 GTP-binding proteins [BR:uar04031]     123787269 (RAB5B) Membrane trafficking [BR:uar04131]  Endocytosis   Rab GTPases and associated proteins    Rab GTPases     123787269 (RAB5B)  Endosome - Lysosome transport     123787269 (RAB5B) Exosome [BR:uar04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    123787269 (RAB5B)   Exosomal proteins of other body fluids (saliva and urine)    123787269 (RAB5B)   Exosomal proteins of colorectal cancer cells    123787269 (RAB5B)   Exosomal proteins of melanoma cells    123787269 (RAB5B) GTP-binding proteins [BR:uar04031]  Small (monomeric) G-proteins   Rab Family    Rab5/17/22/31 [OT]     123787269 (RAB5B) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 Gtr1_RagA RsgA_GTPase AAA_16 Motif Other DBs NCBI-GeneID:  123787269 NCBI-ProteinID:  XP_045645870 UniProt:  A0A452RHT5 LinkDB All DBs Position Unknown AA seq 215 aa AA seqDB search MTSRSTARPNGQPQASKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQ SVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNQETFARAKTWVKELQR QASPSIVIALAGNKADLANKRMVEYEEAQAYADDNSLLFMETSAKTAMNVNDLFLAIAKK LPKSEPQNLGGAACRSRGVDLHEQSQQNKSQCCSN NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atgactagcagaagcacagccaggcccaatgggcagccccaggccagcaaaatatgccag ttcaaattggtcctgctgggtgaatctgcagtggggaagtctagcctggtattacgtttt gtcaaagggcagttccatgagtaccaagagagcaccattggagctgccttcctcacccag tctgtttgtctagatgacacaacagtcaagtttgagatctgggacacagctgggcaggaa cgataccatagcttggcccccatgtactacagaggtgcccaagctgccattgtggtttat gacattactaatcaggaaaccttcgcccgagcgaagacatgggtaaaggaactacagcga caggccagtcctagcatcgttattgccttggcggggaacaaagctgaccttgccaataag cgcatggtggagtatgaagaggcccaggcgtatgcagatgacaacagcttattgtttatg gagacttcagccaagacagctatgaacgtgaacgatctcttcctggcaatagctaagaag ttgccaaagagtgaaccccagaatctggggggtgcagcatgccgaagccggggtgtggat ctccatgagcagtcccagcagaacaagagccagtgttgtagcaactga

DBGET integrated database retrieval system