Ursus americanus (American black bear): 123787680 Help Entry 123787680         CDS       T07931                                  Name (RefSeq) thioredoxin-like   KO K03671   thioredoxin Organism uar  Ursus americanus (American black bear) Pathway uar04621   NOD-like receptor signaling pathway uar05012   Parkinson disease uar05132   Salmonella infection uar05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:uar00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     123787680  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     123787680   09164 Neurodegenerative disease    05012 Parkinson disease     123787680   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     123787680  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:uar03110]     123787680 Chaperones and folding catalysts [BR:uar03110]  Protein folding catalysts   Protein disulfide isomerase    123787680 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Thioredoxin Thioredoxin_8 Thioredoxin_2 Thioredoxin_7 AhpC-TSA DIM1 Thioredoxin_9 Redoxin Glutaredoxin OST3_OST6 Motif Other DBs NCBI-GeneID:  123787680 NCBI-ProteinID:  XP_045646448 UniProt:  A0A452QB39 LinkDB All DBs Position Unknown AA seq 105 aa AA seqDB search MVKQIKSKYSFQEALNSAGDKPVVVDFSATWCGPCKMTKPFFHPLSEKYSNVVSLEVDVD DCQDVASECKVKCMPTFHFFKKGQKVGEFSGTNKGKLEATINELT NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atggtgaagcagataaagagcaagtattcttttcaggaagccttgaacagtgcaggagat aaaccagttgtagttgacttctcagccacatggtgtgggccttgcaaaatgaccaagcct ttctttcatcccctctctgagaagtattccaacgtggtatcccttgaagtagatgtggat gactgtcaggatgtcgcttcagaatgtaaagtcaaatgcatgccaaccttccattttttt aaaaagggacaaaaggtgggtgaattttctggaactaataaggggaaacttgaagctacc attaatgaattaacctaa

DBGET integrated database retrieval system