Ursus americanus (American black bear): 123788629 Help Entry 123788629         CDS       T07931                                  Symbol IL12B Name (RefSeq) interleukin-12 subunit beta   KO K05425   interleukin 12B Organism uar  Ursus americanus (American black bear) Pathway uar04060   Cytokine-cytokine receptor interaction uar04620   Toll-like receptor signaling pathway uar04622   RIG-I-like receptor signaling pathway uar04625   C-type lectin receptor signaling pathway uar04630   JAK-STAT signaling pathway uar04658   Th1 and Th2 cell differentiation uar04936   Alcoholic liver disease uar04940   Type I diabetes mellitus uar05133   Pertussis uar05134   Legionellosis uar05140   Leishmaniasis uar05142   Chagas disease uar05143   African trypanosomiasis uar05145   Toxoplasmosis uar05146   Amoebiasis uar05152   Tuberculosis uar05162   Measles uar05164   Influenza A uar05168   Herpes simplex virus 1 infection uar05171   Coronavirus disease - COVID-19 uar05200   Pathways in cancer uar05205   Proteoglycans in cancer uar05321   Inflammatory bowel disease uar05330   Allograft rejection uar05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:uar00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     123788629 (IL12B)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     123788629 (IL12B)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     123788629 (IL12B)    04622 RIG-I-like receptor signaling pathway     123788629 (IL12B)    04625 C-type lectin receptor signaling pathway     123788629 (IL12B)    04658 Th1 and Th2 cell differentiation     123788629 (IL12B)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     123788629 (IL12B)    05205 Proteoglycans in cancer     123788629 (IL12B)   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     123788629 (IL12B)    05164 Influenza A     123788629 (IL12B)    05162 Measles     123788629 (IL12B)    05168 Herpes simplex virus 1 infection     123788629 (IL12B)   09171 Infectious disease: bacterial    05133 Pertussis     123788629 (IL12B)    05134 Legionellosis     123788629 (IL12B)    05152 Tuberculosis     123788629 (IL12B)   09174 Infectious disease: parasitic    05146 Amoebiasis     123788629 (IL12B)    05145 Toxoplasmosis     123788629 (IL12B)    05140 Leishmaniasis     123788629 (IL12B)    05142 Chagas disease     123788629 (IL12B)    05143 African trypanosomiasis     123788629 (IL12B)   09163 Immune disease    05321 Inflammatory bowel disease     123788629 (IL12B)    05330 Allograft rejection     123788629 (IL12B)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     123788629 (IL12B)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     123788629 (IL12B)    04936 Alcoholic liver disease     123788629 (IL12B)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:uar04052]     123788629 (IL12B)    00536 Glycosaminoglycan binding proteins [BR:uar00536]     123788629 (IL12B) Cytokines and neuropeptides [BR:uar04052]  Cytokines   Interleukins    123788629 (IL12B) Glycosaminoglycan binding proteins [BR:uar00536]  Heparan sulfate / Heparin   Cytokines    123788629 (IL12B) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL12p40_C Ig_3 Ig_5 Ig_2 Ig_4 fn3 ig DBD_Tnp_Mut Motif Other DBs NCBI-GeneID:  123788629 NCBI-ProteinID:  XP_045648102 LinkDB All DBs Position Unknown AA seq 329 aa AA seqDB search MQPQQLVVSWFSLVLLASPLMAVWELEKNVYVVELDWHPDAPGEVVVLTCHTPEEDDITW TSDQSSEVLGSGKTLTVQVKEFGDAGRYTCHKGGKVLSDSLLLIHKKEDGIWSTDILKEQ KESKNRIFLKCEAKNYSGRFTCWWLTAISTDLKFSVKSSRGFSDPQGVTCGAVTLSADRV RVDNRDYKKYTVECQEGSACPTAEESLPIEVVVDAIHKLKYENYTRSFFIRDIIKPDPPM NLQLKPLKNSRHVEVSWEYPDTWSTPHSYFSLTFCIQGQGKNHREKKERLCVDKTSAKVT CPREAKIRVQARDRYYSSSWSDWAAVSCT NT seq 990 nt NT seq  +upstreamnt  +downstreamnt atgcagccgcagcagctggtcgtctcctggttctccctggttctgttggcatctcccctc atggccgtatgggaactggagaaaaatgtttatgttgtagagttggactggcacccggac gcccccggagaggtggtggtcctcacctgccatacccctgaagaggatgacatcacctgg acctcagaccagagcagtgaagtcttaggctctggtaaaactctgaccgtccaagtcaaa gaatttggagatgctggccggtatacctgtcataaaggaggcaaggttctgagcgattcg ctcctgctgattcacaaaaaggaagatggaatctggtccactgatatcttaaaggaacag aaagaatccaaaaataggatctttctaaaatgtgaggcaaagaattattctggacgtttc acctgctggtggctgacggcaatcagtactgacttgaaattcagtgtcaaaagcagcaga ggcttctctgacccccaaggcgtgacgtgtggagcagtgacactctcagcagacagggtc agagtggacaacagggattataagaagtacacggtggagtgtcaggagggcagcgcctgc cccacagccgaggagagcctacccatcgaggtcgtggtggacgctattcacaagctcaag tatgaaaactacaccaggagcttcttcatcagggacatcatcaaaccggacccgcccatg aacctgcagctgaagcccttaaaaaattctcggcatgtggaggtcagctgggaatacccc gacacttggagcaccccgcattcctacttctccctgacattctgcatacagggccagggc aagaaccatcgggaaaagaaagagagactctgcgtggacaagacctcggccaaggtcacg tgccccagggaggccaagatccgcgtgcaagcccgagaccgctactacagctcatcctgg agcgactgggcagctgtgtcctgcacttag

DBGET integrated database retrieval system