Ursus americanus (American black bear): 123789115 Help Entry 123789115         CDS       T07931                                  Symbol CXCL8 Name (RefSeq) interleukin-8   KO K10030   interleukin 8 Organism uar  Ursus americanus (American black bear) Pathway uar04060   Cytokine-cytokine receptor interaction uar04061   Viral protein interaction with cytokine and cytokine receptor uar04062   Chemokine signaling pathway uar04064   NF-kappa B signaling pathway uar04072   Phospholipase D signaling pathway uar04218   Cellular senescence uar04620   Toll-like receptor signaling pathway uar04621   NOD-like receptor signaling pathway uar04622   RIG-I-like receptor signaling pathway uar04657   IL-17 signaling pathway uar04932   Non-alcoholic fatty liver disease uar04933   AGE-RAGE signaling pathway in diabetic complications uar04936   Alcoholic liver disease uar05132   Salmonella infection uar05133   Pertussis uar05134   Legionellosis uar05135   Yersinia infection uar05142   Chagas disease uar05144   Malaria uar05146   Amoebiasis uar05161   Hepatitis B uar05163   Human cytomegalovirus infection uar05164   Influenza A uar05167   Kaposi sarcoma-associated herpesvirus infection uar05171   Coronavirus disease - COVID-19 uar05200   Pathways in cancer uar05202   Transcriptional misregulation in cancer uar05219   Bladder cancer uar05323   Rheumatoid arthritis uar05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:uar00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     123789115 (CXCL8)    04072 Phospholipase D signaling pathway     123789115 (CXCL8)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     123789115 (CXCL8)    04061 Viral protein interaction with cytokine and cytokine receptor     123789115 (CXCL8)  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     123789115 (CXCL8)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     123789115 (CXCL8)    04621 NOD-like receptor signaling pathway     123789115 (CXCL8)    04622 RIG-I-like receptor signaling pathway     123789115 (CXCL8)    04657 IL-17 signaling pathway     123789115 (CXCL8)    04062 Chemokine signaling pathway     123789115 (CXCL8)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     123789115 (CXCL8)    05202 Transcriptional misregulation in cancer     123789115 (CXCL8)   09162 Cancer: specific types    05219 Bladder cancer     123789115 (CXCL8)   09172 Infectious disease: viral    05161 Hepatitis B     123789115 (CXCL8)    05171 Coronavirus disease - COVID-19     123789115 (CXCL8)    05164 Influenza A     123789115 (CXCL8)    05163 Human cytomegalovirus infection     123789115 (CXCL8)    05167 Kaposi sarcoma-associated herpesvirus infection     123789115 (CXCL8)   09171 Infectious disease: bacterial    05132 Salmonella infection     123789115 (CXCL8)    05135 Yersinia infection     123789115 (CXCL8)    05133 Pertussis     123789115 (CXCL8)    05134 Legionellosis     123789115 (CXCL8)   09174 Infectious disease: parasitic    05146 Amoebiasis     123789115 (CXCL8)    05144 Malaria     123789115 (CXCL8)    05142 Chagas disease     123789115 (CXCL8)   09163 Immune disease    05323 Rheumatoid arthritis     123789115 (CXCL8)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     123789115 (CXCL8)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     123789115 (CXCL8)    04932 Non-alcoholic fatty liver disease     123789115 (CXCL8)    04933 AGE-RAGE signaling pathway in diabetic complications     123789115 (CXCL8)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:uar04052]     123789115 (CXCL8)    00536 Glycosaminoglycan binding proteins [BR:uar00536]     123789115 (CXCL8) Cytokines and neuropeptides [BR:uar04052]  Cytokines   Chemokines    123789115 (CXCL8) Glycosaminoglycan binding proteins [BR:uar00536]  Heparan sulfate / Heparin   Chemokines    123789115 (CXCL8) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  123789115 NCBI-ProteinID:  XP_045648902 UniProt:  A0A452RMQ7 LinkDB All DBs Position Unknown AA seq 101 aa AA seqDB search MTSKLAVALLAVFLLSSALCEAAVLSRMSSELRCQCIKTHSTPFHPKYIRELRVIESGPY CENSEIIVKLVNGEEVCLDPKEPWVQKIVQIFLKRAEKQKP NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgacttccaagctggctgttgctctcttggcagttttcctgctctcttcagcactgtgt gaagctgcagttctgtcaagaatgagttcagaacttcgatgccagtgcataaagactcac tctacgcctttccatcccaaatacatcagagagctgagagtgattgagagtggtccatat tgtgaaaactcagaaatcattgtaaagcttgtcaatggagaagaggtgtgcctggacccc aaggaaccatgggtacagaagattgtgcagatatttttgaagagggctgagaaacagaaa ccatga

DBGET integrated database retrieval system