Ursus americanus (American black bear): 123790113 Help Entry 123790113         CDS       T07931                                  Symbol PRLH Name (RefSeq) prolactin-releasing peptide   KO K05269   prolactin-releasing peptide Organism uar  Ursus americanus (American black bear) Pathway uar04080   Neuroactive ligand-receptor interaction uar04081   Hormone signaling Brite KEGG Orthology (KO) [BR:uar00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     123790113 (PRLH)    04081 Hormone signaling     123790113 (PRLH)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:uar04052]     123790113 (PRLH) Cytokines and neuropeptides [BR:uar04052]  Neuropeptides   GPCR binding    123790113 (PRLH) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Prolactin_RP LEAP-2 Motif Other DBs NCBI-GeneID:  123790113 NCBI-ProteinID:  XP_045650166 UniProt:  A0A452SM90 LinkDB All DBs Position Unknown AA seq 87 aa AA seqDB search MKALQAWLVCLLLLGLALKGAAGQAHQHSMEIRTPDLDPAWYTGRRIRPVGRFGRRRAAL GDAAKPSLWHQPACFPLQGGAQPAQDG NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgaaggctttgcaggcctggctcgtgtgcctgctgctgctgggcctggccctgaagggg gccgccggccaagcccaccagcattccatggagatccgcacccccgacctcgatcctgcc tggtacacgggccgcagaatcaggcctgtgggccgcttcggccggaggagagcggccctg ggggacgcagcgaagccgagcctctggcaccagcccgcctgcttccccctgcaaggaggc gcccagcccgcccaggatgggtga

DBGET integrated database retrieval system