Ursus americanus (American black bear): 123790368 Help Entry 123790368         CDS       T07931                                  Symbol IL5 Name (RefSeq) interleukin-5   KO K05428   interleukin 5 Organism uar  Ursus americanus (American black bear) Pathway uar04060   Cytokine-cytokine receptor interaction uar04630   JAK-STAT signaling pathway uar04640   Hematopoietic cell lineage uar04657   IL-17 signaling pathway uar04658   Th1 and Th2 cell differentiation uar04660   T cell receptor signaling pathway uar04664   Fc epsilon RI signaling pathway uar04672   Intestinal immune network for IgA production uar05200   Pathways in cancer uar05310   Asthma uar05320   Autoimmune thyroid disease uar05321   Inflammatory bowel disease uar05330   Allograft rejection Brite KEGG Orthology (KO) [BR:uar00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     123790368 (IL5)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     123790368 (IL5)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     123790368 (IL5)    04660 T cell receptor signaling pathway     123790368 (IL5)    04658 Th1 and Th2 cell differentiation     123790368 (IL5)    04657 IL-17 signaling pathway     123790368 (IL5)    04664 Fc epsilon RI signaling pathway     123790368 (IL5)    04672 Intestinal immune network for IgA production     123790368 (IL5)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     123790368 (IL5)   09163 Immune disease    05310 Asthma     123790368 (IL5)    05320 Autoimmune thyroid disease     123790368 (IL5)    05321 Inflammatory bowel disease     123790368 (IL5)    05330 Allograft rejection     123790368 (IL5)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:uar04052]     123790368 (IL5)    00536 Glycosaminoglycan binding proteins [BR:uar00536]     123790368 (IL5) Cytokines and neuropeptides [BR:uar04052]  Cytokines   Interleukins    123790368 (IL5) Glycosaminoglycan binding proteins [BR:uar00536]  Heparan sulfate / Heparin   Cytokines    123790368 (IL5) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL5 Motif Other DBs NCBI-GeneID:  123790368 NCBI-ProteinID:  XP_045650690 LinkDB All DBs Position Unknown AA seq 134 aa AA seqDB search MRMLLHLSLLALGAAYVSVTAAESTMNGLVAETLTLLSAHRTLLIGDGNLMIPTPEHKNH QLCIEEVFQGIDILKNRTAQEEAVDKLFRNLSLIKQHIEHQKKKCAGERWRVKKFLDYLQ VFLGVINTEWTTES NT seq 405 nt NT seq  +upstreamnt  +downstreamnt atgagaatgcttctgcatttgagtttgctagctcttggggctgcctatgtttctgtcact gctgcagaaagtaccatgaatggactggtggcagagaccttgacactgctctctgctcat cgaactctgctgataggagatgggaacctgatgattcctactcctgaacataaaaatcac caactgtgcattgaagaagtctttcagggcatagacatattgaagaaccgaactgcacaa gaggaggctgtggataaactattccggaacttgtctttaataaaacaacacatagagcac caaaaaaaaaagtgtgcaggagagagatggagagtaaaaaagttcctagactacctgcaa gtgtttcttggtgtcataaacaccgagtggacaacagaaagttga

DBGET integrated database retrieval system