Ursus americanus (American black bear): 123790532 Help Entry 123790532         CDS       T07931                                  Symbol IL9 Name (RefSeq) interleukin-9   KO K05432   interleukin 9 Organism uar  Ursus americanus (American black bear) Pathway uar04060   Cytokine-cytokine receptor interaction uar04630   JAK-STAT signaling pathway uar05310   Asthma Brite KEGG Orthology (KO) [BR:uar00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     123790532 (IL9)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     123790532 (IL9)  09160 Human Diseases   09163 Immune disease    05310 Asthma     123790532 (IL9)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:uar04052]     123790532 (IL9) Cytokines and neuropeptides [BR:uar04052]  Cytokines   Interleukins    123790532 (IL9) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  REC102 Dynamin_M Motif Other DBs NCBI-GeneID:  123790532 NCBI-ProteinID:  XP_045650984 LinkDB All DBs Position Unknown AA seq 116 aa AA seqDB search MTLPTVVLASVLFLCSATSQKCTTFTEILDVTYLIDKLQDNCTTVCFQEGLSQMTNSTAE TRYPLIFNRVKKTVLKNKCQLFSCEQPCNQTTTGNTLTFLQRLREVLQKQRAMDKV NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atgaccctgcccaccgtggtccttgcctctgtcctattcctctgctccgcgaccagccag aagtgtacgacctttacagagatcctagacgtcacgtacctcattgacaaactgcaggac aactgcaccacggtatgcttccaggaaggtctgtcccagatgaccaactccacagcggaa acaagatatcccctgattttcaatcgagtaaaaaaaacagtcttaaagaacaagtgccag ttgttttcctgtgaacagccatgtaaccaaaccacaacaggcaacacgctgacgtttctg cagagactccgggaagttctccagaaacaaagggcaatggacaaagtatga

DBGET integrated database retrieval system