Ursus americanus (American black bear): 123790538 Help Entry 123790538         CDS       T07931                                  Symbol IL13 Name (RefSeq) interleukin-13   KO K05435   interleukin 13 Organism uar  Ursus americanus (American black bear) Pathway uar04060   Cytokine-cytokine receptor interaction uar04630   JAK-STAT signaling pathway uar04657   IL-17 signaling pathway uar04658   Th1 and Th2 cell differentiation uar04664   Fc epsilon RI signaling pathway uar05200   Pathways in cancer uar05310   Asthma uar05321   Inflammatory bowel disease Brite KEGG Orthology (KO) [BR:uar00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     123790538 (IL13)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     123790538 (IL13)  09150 Organismal Systems   09151 Immune system    04658 Th1 and Th2 cell differentiation     123790538 (IL13)    04657 IL-17 signaling pathway     123790538 (IL13)    04664 Fc epsilon RI signaling pathway     123790538 (IL13)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     123790538 (IL13)   09163 Immune disease    05310 Asthma     123790538 (IL13)    05321 Inflammatory bowel disease     123790538 (IL13)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:uar04052]     123790538 (IL13) Cytokines and neuropeptides [BR:uar04052]  Cytokines   Interleukins    123790538 (IL13) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL13 GCIP_N Motif Other DBs NCBI-GeneID:  123790538 NCBI-ProteinID:  XP_045650989 LinkDB All DBs Position Unknown AA seq 131 aa AA seqDB search MALWLTVVIALTCLGGLASPGPVPSHKALRELIEELVNITQNQASLCNGSMVWSVNQTAS MYCAALESLLNVSDCSAIQRTQRMLKAMCLHTPSAGHLSSLRSQDTKIEVIQLVKNLLTH VRRHFRHGNFT NT seq 396 nt NT seq  +upstreamnt  +downstreamnt atggcgctctggttgactgtggtcattgctctcacctgccttggtggccttgcctcccca ggccctgtgccttcccacaaagccctcagggagctcattgaggaactggtcaacatcacc cagaatcaggcgtccctctgcaatggcagcatggtgtggagtgtcaaccagaccgccagc atgtactgcgcagctctagaatctttgctcaatgtctctgactgcagcgccatccaaagg actcagaggatgctgaaagccatgtgccttcacactccctcggcagggcacctttccagt ctgcgcagccaagacaccaaaattgaagtgatccagttggtgaaaaacctgctcacccat gtacggagacattttcgccatggaaatttcacatga

DBGET integrated database retrieval system