Ursus americanus (American black bear): 123791006 Help Entry 123791006         CDS       T07931                                  Symbol CSNK2B Name (RefSeq) casein kinase II subunit beta   KO K03115   casein kinase II subunit beta Organism uar  Ursus americanus (American black bear) Pathway uar03008   Ribosome biogenesis in eukaryotes uar03083   Polycomb repressive complex uar04064   NF-kappa B signaling pathway uar04137   Mitophagy - animal uar04310   Wnt signaling pathway uar04520   Adherens junction uar05010   Alzheimer disease uar05020   Prion disease uar05022   Pathways of neurodegeneration - multiple diseases uar05162   Measles uar05235   PD-L1 expression and PD-1 checkpoint pathway in cancer Brite KEGG Orthology (KO) [BR:uar00001]  09120 Genetic Information Processing   09122 Translation    03008 Ribosome biogenesis in eukaryotes     123791006 (CSNK2B)   09126 Chromosome    03083 Polycomb repressive complex     123791006 (CSNK2B)  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     123791006 (CSNK2B)    04064 NF-kappa B signaling pathway     123791006 (CSNK2B)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     123791006 (CSNK2B)   09144 Cellular community - eukaryotes    04520 Adherens junction     123791006 (CSNK2B)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     123791006 (CSNK2B)   09172 Infectious disease: viral    05162 Measles     123791006 (CSNK2B)   09164 Neurodegenerative disease    05010 Alzheimer disease     123791006 (CSNK2B)    05020 Prion disease     123791006 (CSNK2B)    05022 Pathways of neurodegeneration - multiple diseases     123791006 (CSNK2B)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03009 Ribosome biogenesis [BR:uar03009]     123791006 (CSNK2B)    03036 Chromosome and associated proteins [BR:uar03036]     123791006 (CSNK2B) Ribosome biogenesis [BR:uar03009]  Eukaryotic type   90S particles    Kinase     123791006 (CSNK2B) Chromosome and associated proteins [BR:uar03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.3/1.5)      123791006 (CSNK2B) SSDB OrthologParalogGFIT Motif Pfam:  CK_II_beta Motif Other DBs NCBI-GeneID:  123791006 NCBI-ProteinID:  XP_045651617 LinkDB All DBs Position Unknown AA seq 215 aa AA seqDB search MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDE ELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPML PIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPA NQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atgagcagctcagaggaggtgtcctggatttcctggttctgtgggctccgtggcaatgaa ttcttctgtgaagtggatgaagactacatccaggacaaattcaatctcactggactcaat gagcaggtgcctcactatcgacaagctctagacatgatcttggacctggagcctgatgaa gagctggaagacaaccccaaccagagcgacctgattgagcaggcagccgagatgctttat ggattgatccacgcccgctatatcctcaccaaccgtggcatcgcccagatgttggaaaag taccagcagggagactttggctactgtccccgtgtgtactgtgagaaccagccaatgctt cccatcggcctttcggacatcccaggtgaggccatggtgaagctctactgccccaagtgc atggacgtgtacacacccaagtcatcgaggcaccatcacacggacggcgcctacttcggc accggtttccctcacatgctcttcatggtgcaccccgagtaccggcccaagcggcccgcc aaccagtttgtgcccaggctctacggtttcaagatccatccaatggcctaccagctgcag ctccaagccgccagcaacttcaagagcccagtcaagacgattcgctga

DBGET integrated database retrieval system