Ursus americanus (American black bear): 123791793 Help Entry 123791793         CDS       T07931                                  Name (RefSeq) histone H3.3A isoform X1   KO K11253   histone H3 Organism uar  Ursus americanus (American black bear) Pathway uar04613   Neutrophil extracellular trap formation uar05034   Alcoholism uar05202   Transcriptional misregulation in cancer uar05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:uar00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     123791793  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     123791793   09163 Immune disease    05322 Systemic lupus erythematosus     123791793   09165 Substance dependence    05034 Alcoholism     123791793  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:uar03036]     123791793   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:uar04147]     123791793 Chromosome and associated proteins [BR:uar03036]  Eukaryotic type   Nucleosome assembly factors    Histones     123791793 Exosome [BR:uar04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    123791793 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone PAF Motif Other DBs NCBI-GeneID:  123791793 NCBI-ProteinID:  XP_045652707 LinkDB All DBs Position Unknown AA seq 160 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQISELELFTVHHHLRDEAESLFPWEQS VADQHRLKRQARPIWWASSKTPTCVLSMPNVSQLCQKTSS NT seq 483 nt NT seq  +upstreamnt  +downstreamnt atggctcgtacaaagcagactgcccgcaaatctaccggtggtaaagcaccaaggaagcaa ctggctacaaaagccgctcgcaagagtgcgccctctactggaggggtgaagaaacctcat cgttacaggcctggtactgtggcactccgtgaaattagacgttatcagaagtccactgaa cttctgatccgcaaacttcctttccagcgtctggtgcgagaaattgctcaggacttcaaa acagatctgcgcttccagagtgcagctatcggtgctttgcagatttccgaacttgaactt ttcactgttcatcaccatctgcgggacgaagctgaaagcctctttccgtgggagcagtcc gtagcggatcagcatcgcctgaagaggcaagcgaggcctatctggtgggcctcttcgaag acaccaacctgtgtgctatccatgccaaacgtgtcacaattatgccaaaagacatccagc tag

DBGET integrated database retrieval system