Ursus americanus (American black bear): 123791855 Help Entry 123791855         CDS       T07931                                  Symbol PFN3 Name (RefSeq) profilin-3   KO K05759   profilin Organism uar  Ursus americanus (American black bear) Pathway uar04015   Rap1 signaling pathway uar04810   Regulation of actin cytoskeleton uar05014   Amyotrophic lateral sclerosis uar05132   Salmonella infection Brite KEGG Orthology (KO) [BR:uar00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     123791855 (PFN3)  09160 Human Diseases   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     123791855 (PFN3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:uar04131]     123791855 (PFN3)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:uar04812]     123791855 (PFN3)    04147 Exosome [BR:uar04147]     123791855 (PFN3) Membrane trafficking [BR:uar04131]  Others   Actin-binding proteins    Others     123791855 (PFN3) Cytoskeleton proteins [BR:uar04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      123791855 (PFN3) Exosome [BR:uar04147]  Exosomal proteins   Proteins found in most exosomes    123791855 (PFN3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  123791855 NCBI-ProteinID:  XP_045652822 LinkDB All DBs Position Unknown AA seq 137 aa AA seqDB search MGDWKGYISAVLRDQRIDDVAIVGHSDNRCVWASRPGGLLAAISPQEVGVLTGPDRRTFL QAGLSVAGRRCCVIRDHLLSEGDGVLDARTKGLDGRAVCVGHTPRVLLVLMGRRGVHGGI LNKTVHELIKGLRTQGT NT seq 414 nt NT seq  +upstreamnt  +downstreamnt atgggagactggaaaggctatatcagtgcggtgctgcgggaccagcgcattgacgatgtg gccatcgtgggccactcagacaatcgctgcgtgtgggcatcgcgtccaggaggccttctg gctgccatatcaccgcaagaggtgggtgtgctcacagggcctgatcggcgcaccttcctg caggccggcctgagcgtggcaggccgccgctgctgcgtcatccgcgaccacttgctgtct gagggcgatggagttctggacgcacgcactaaggggctggatgggcgtgcggtctgcgtg ggccacaccccgcgcgtgctcctcgtgctcatgggccgacggggcgtgcacgggggcatc ctcaacaagacagtgcatgaactaatcaaggggctgcgcacacagggcacctag

DBGET integrated database retrieval system