Ursus americanus (American black bear): 123792165 Help Entry 123792165         CDS       T07931                                  Symbol CLDN7 Name (RefSeq) claudin-7   KO K06087   claudin Organism uar  Ursus americanus (American black bear) Pathway uar03272   Virion - Hepatitis viruses uar04382   Cornified envelope formation uar04514   Cell adhesion molecules uar04530   Tight junction uar04670   Leukocyte transendothelial migration uar05160   Hepatitis C Brite KEGG Orthology (KO) [BR:uar00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     123792165 (CLDN7)  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     123792165 (CLDN7)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     123792165 (CLDN7)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     123792165 (CLDN7)   09158 Development and regeneration    04382 Cornified envelope formation     123792165 (CLDN7)  09160 Human Diseases   09172 Infectious disease: viral    05160 Hepatitis C     123792165 (CLDN7)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:uar03037]     123792165 (CLDN7)    04147 Exosome [BR:uar04147]     123792165 (CLDN7)    04515 Cell adhesion molecules [BR:uar04515]     123792165 (CLDN7) Cilium and associated proteins [BR:uar03037]  Other cilia and associated proteins   Stereociliary proteins    123792165 (CLDN7) Exosome [BR:uar04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    123792165 (CLDN7)   Exosomal proteins of colorectal cancer cells    123792165 (CLDN7) Cell adhesion molecules [BR:uar04515]  Immunoglobulin superfamily   L1 family    123792165 (CLDN7) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PMP22_Claudin Claudin_2 Clc-like OppC_N Motif Other DBs NCBI-GeneID:  123792165 NCBI-ProteinID:  XP_045653354 UniProt:  A0A452RHY9 LinkDB All DBs Position Unknown AA seq 211 aa AA seqDB search MANSGLQLLGFALALLGWVGLVACTAIPQWQMSSYAGDNIITAQAMYKGLWMECITQSTG LMSCKSYDSVLALSAALQATRALMVVSLVLGFLAMFVATMGMKCTNCGGDDKVKKARIAM TGGIIFIVSGLAALVACSWYGHQIVTDFYSALVPMNLKYEFGPAIFIGWAGSALVILGGA LLSCSCPGSEGKTGYRAPRSYPKPNSAKEYV NT seq 636 nt NT seq  +upstreamnt  +downstreamnt atggccaattcgggcctgcagctcctgggcttcgccctggctctgctgggctgggtgggc ctggtggcgtgcaccgccatcccgcagtggcaaatgagctcgtacgcgggcgacaacatc atcacggcccaggccatgtacaaggggctgtggatggaatgcatcacgcagagcacgggc ctgatgagctgcaaatcgtacgactcggtgctcgccctgtcggcggccctgcaggccacc cgagccctgatggtggtatccctggtgctgggcttcctggccatgttcgtggccaccatg ggcatgaagtgcacgaactgtgggggagacgacaaagtgaaaaaggcccggatagccatg accggaggtatcattttcatcgtgtcaggtcttgctgccttggtagcttgttcttggtac ggccaccagattgtcacagatttctatagcgcgctggtccccatgaatcttaagtacgag tttggtcctgccatcttcattggctgggcagggtctgctctggtcatcctgggaggtgcc ctgctctcttgctcctgtcctgggagtgagggcaaaactgggtaccgcgcaccccgctcc taccctaagcccaactccgccaaggagtacgtgtga

DBGET integrated database retrieval system