Ursus americanus (American black bear): 123793114 Help Entry 123793114         CDS       T07931                                  Symbol IL2 Name (RefSeq) interleukin-2   KO K05429   interleukin 2 Organism uar  Ursus americanus (American black bear) Pathway uar04060   Cytokine-cytokine receptor interaction uar04061   Viral protein interaction with cytokine and cytokine receptor uar04151   PI3K-Akt signaling pathway uar04625   C-type lectin receptor signaling pathway uar04630   JAK-STAT signaling pathway uar04658   Th1 and Th2 cell differentiation uar04659   Th17 cell differentiation uar04660   T cell receptor signaling pathway uar04672   Intestinal immune network for IgA production uar04940   Type I diabetes mellitus uar05135   Yersinia infection uar05142   Chagas disease uar05162   Measles uar05166   Human T-cell leukemia virus 1 infection uar05171   Coronavirus disease - COVID-19 uar05200   Pathways in cancer uar05320   Autoimmune thyroid disease uar05321   Inflammatory bowel disease uar05330   Allograft rejection uar05332   Graft-versus-host disease Brite KEGG Orthology (KO) [BR:uar00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     123793114 (IL2)    04151 PI3K-Akt signaling pathway     123793114 (IL2)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     123793114 (IL2)    04061 Viral protein interaction with cytokine and cytokine receptor     123793114 (IL2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     123793114 (IL2)    04660 T cell receptor signaling pathway     123793114 (IL2)    04658 Th1 and Th2 cell differentiation     123793114 (IL2)    04659 Th17 cell differentiation     123793114 (IL2)    04672 Intestinal immune network for IgA production     123793114 (IL2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     123793114 (IL2)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     123793114 (IL2)    05171 Coronavirus disease - COVID-19     123793114 (IL2)    05162 Measles     123793114 (IL2)   09171 Infectious disease: bacterial    05135 Yersinia infection     123793114 (IL2)   09174 Infectious disease: parasitic    05142 Chagas disease     123793114 (IL2)   09163 Immune disease    05320 Autoimmune thyroid disease     123793114 (IL2)    05321 Inflammatory bowel disease     123793114 (IL2)    05330 Allograft rejection     123793114 (IL2)    05332 Graft-versus-host disease     123793114 (IL2)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     123793114 (IL2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:uar04052]     123793114 (IL2)    00536 Glycosaminoglycan binding proteins [BR:uar00536]     123793114 (IL2) Cytokines and neuropeptides [BR:uar04052]  Cytokines   Interleukins    123793114 (IL2) Glycosaminoglycan binding proteins [BR:uar00536]  Heparan sulfate / Heparin   Cytokines    123793114 (IL2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL2 Portal_T4 Motif Other DBs NCBI-GeneID:  123793114 NCBI-ProteinID:  XP_045654595 UniProt:  A0A452SAK8 LinkDB All DBs Position Unknown AA seq 155 aa AA seqDB search MYKMQLLYCIALTLVLVANSAPTTSSPTKETQQQLEQLLLDLRLLLNGVNNYENPKLSRM LTFKFYMPKKATELKHLQCLAEELKLLEEVLYLDQSKNLHLTDIKELMSNINVTLLKLKG SEASFKCEYDDETVTITEFLNKWITFCQSIFSTLT NT seq 468 nt NT seq  +upstreamnt  +downstreamnt atgtacaaaatgcaactcttgtattgcatcgcactgactcttgtactcgtcgcaaacagt gcacctactacttcaagccctacgaaggaaacacagcaacagctggagcaattgctgctg gatttacggttgctcttgaatggagttaataattatgagaaccccaaactctccaggatg ctcacgtttaaattctacatgcccaagaaggccacagaattgaaacatcttcaatgtcta gcagaagaactcaaacttctggaggaagtgctatatttagatcaaagcaaaaaccttcac ttgacagacatcaaggaattaatgagcaatatcaatgtaacacttctgaaactaaaggga tcagaagcaagtttcaaatgtgaatatgatgacgagacagtaaccattacagaatttctg aacaaatggattactttttgtcaaagcatcttctcaacactgacttga

DBGET integrated database retrieval system