Ursus americanus (American black bear): 123793902 Help Entry 123793902         CDS       T07931                                  Symbol NFKBIA Name (RefSeq) NF-kappa-B inhibitor alpha   KO K04734   NF-kappa-B inhibitor alpha Organism uar  Ursus americanus (American black bear) Pathway uar04024   cAMP signaling pathway uar04062   Chemokine signaling pathway uar04064   NF-kappa B signaling pathway uar04210   Apoptosis uar04380   Osteoclast differentiation uar04620   Toll-like receptor signaling pathway uar04621   NOD-like receptor signaling pathway uar04622   RIG-I-like receptor signaling pathway uar04623   Cytosolic DNA-sensing pathway uar04625   C-type lectin receptor signaling pathway uar04657   IL-17 signaling pathway uar04658   Th1 and Th2 cell differentiation uar04659   Th17 cell differentiation uar04660   T cell receptor signaling pathway uar04662   B cell receptor signaling pathway uar04668   TNF signaling pathway uar04722   Neurotrophin signaling pathway uar04920   Adipocytokine signaling pathway uar04926   Relaxin signaling pathway uar04931   Insulin resistance uar04936   Alcoholic liver disease uar05132   Salmonella infection uar05134   Legionellosis uar05135   Yersinia infection uar05140   Leishmaniasis uar05142   Chagas disease uar05145   Toxoplasmosis uar05160   Hepatitis C uar05161   Hepatitis B uar05162   Measles uar05163   Human cytomegalovirus infection uar05164   Influenza A uar05166   Human T-cell leukemia virus 1 infection uar05167   Kaposi sarcoma-associated herpesvirus infection uar05168   Herpes simplex virus 1 infection uar05169   Epstein-Barr virus infection uar05170   Human immunodeficiency virus 1 infection uar05171   Coronavirus disease - COVID-19 uar05200   Pathways in cancer uar05203   Viral carcinogenesis uar05208   Chemical carcinogenesis - reactive oxygen species uar05215   Prostate cancer uar05220   Chronic myeloid leukemia uar05222   Small cell lung cancer uar05235   PD-L1 expression and PD-1 checkpoint pathway in cancer uar05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:uar00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     123793902 (NFKBIA)    04668 TNF signaling pathway     123793902 (NFKBIA)    04024 cAMP signaling pathway     123793902 (NFKBIA)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     123793902 (NFKBIA)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     123793902 (NFKBIA)    04621 NOD-like receptor signaling pathway     123793902 (NFKBIA)    04622 RIG-I-like receptor signaling pathway     123793902 (NFKBIA)    04623 Cytosolic DNA-sensing pathway     123793902 (NFKBIA)    04625 C-type lectin receptor signaling pathway     123793902 (NFKBIA)    04660 T cell receptor signaling pathway     123793902 (NFKBIA)    04658 Th1 and Th2 cell differentiation     123793902 (NFKBIA)    04659 Th17 cell differentiation     123793902 (NFKBIA)    04657 IL-17 signaling pathway     123793902 (NFKBIA)    04662 B cell receptor signaling pathway     123793902 (NFKBIA)    04062 Chemokine signaling pathway     123793902 (NFKBIA)   09152 Endocrine system    04920 Adipocytokine signaling pathway     123793902 (NFKBIA)    04926 Relaxin signaling pathway     123793902 (NFKBIA)   09156 Nervous system    04722 Neurotrophin signaling pathway     123793902 (NFKBIA)   09158 Development and regeneration    04380 Osteoclast differentiation     123793902 (NFKBIA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     123793902 (NFKBIA)    05208 Chemical carcinogenesis - reactive oxygen species     123793902 (NFKBIA)    05203 Viral carcinogenesis     123793902 (NFKBIA)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     123793902 (NFKBIA)   09162 Cancer: specific types    05220 Chronic myeloid leukemia     123793902 (NFKBIA)    05215 Prostate cancer     123793902 (NFKBIA)    05222 Small cell lung cancer     123793902 (NFKBIA)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     123793902 (NFKBIA)    05170 Human immunodeficiency virus 1 infection     123793902 (NFKBIA)    05161 Hepatitis B     123793902 (NFKBIA)    05160 Hepatitis C     123793902 (NFKBIA)    05171 Coronavirus disease - COVID-19     123793902 (NFKBIA)    05164 Influenza A     123793902 (NFKBIA)    05162 Measles     123793902 (NFKBIA)    05168 Herpes simplex virus 1 infection     123793902 (NFKBIA)    05163 Human cytomegalovirus infection     123793902 (NFKBIA)    05167 Kaposi sarcoma-associated herpesvirus infection     123793902 (NFKBIA)    05169 Epstein-Barr virus infection     123793902 (NFKBIA)   09171 Infectious disease: bacterial    05132 Salmonella infection     123793902 (NFKBIA)    05135 Yersinia infection     123793902 (NFKBIA)    05134 Legionellosis     123793902 (NFKBIA)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     123793902 (NFKBIA)    05140 Leishmaniasis     123793902 (NFKBIA)    05142 Chagas disease     123793902 (NFKBIA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     123793902 (NFKBIA)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     123793902 (NFKBIA)    04931 Insulin resistance     123793902 (NFKBIA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:uar03000]     123793902 (NFKBIA)    04131 Membrane trafficking [BR:uar04131]     123793902 (NFKBIA) Transcription factors [BR:uar03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    RHR (Rel homology region) Ankyrin only     123793902 (NFKBIA) Membrane trafficking [BR:uar04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     123793902 (NFKBIA) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ank_2 Ank Ank_3 Ank_5 Ank_4 ANK_LRRK2 Motif Other DBs NCBI-GeneID:  123793902 NCBI-ProteinID:  XP_045655916 UniProt:  A0A452SDS0 LinkDB All DBs Position Unknown AA seq 314 aa AA seqDB search MFQPAEHAQDWAMEGPRDALKKERLLDDRHDSGLDSMKDEDYEQLVKELREIRLEPQEAP RGAEPWKQQLTEDGDSFLHLAIIHEEKALTMEVIRQVKGDLAFLNFQNNLQQTPLHLAVI TNQPEIAEALLEAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQTCRTQHLYSILQATN YNGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNSDLVSLLLKCG ADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEDEL PYDDCVLGGQRLTL NT seq 945 nt NT seq  +upstreamnt  +downstreamnt atgttccagcccgccgagcacgcccaggactgggccatggagggtccgcgggacgcgctc aagaaggagcggctgctggacgaccgccacgacagcggcctggactccatgaaggacgag gactacgagcagttggtgaaggagctgcgggagatccgcctcgagccgcaggaggcgccg cggggcgccgagccctggaagcagcagctcaccgaggacggagactcgttcctgcacttg gccatcatccatgaagagaaggcactgaccatggaagtgatccgccaagtgaagggcgac ctggccttcctcaacttccagaacaacctgcagcagactccactccacttggctgtgatc accaaccaaccagaaatcgctgaggcacttctggaagctggctgtgatcctgagctccga gactttcgaggaaatacccccctacaccttgcctgtgagcaaggctgcctcgccagtgtg ggagtcctgactcagacctgcaggacccagcacctctactccatcctccaggccaccaac tacaatggtcacacgtgtctacatttggcctctatccatggttacttgggcatcgtggag cttttggtgtctttgggtgctgatgtcaatgctcaggagccctgtaatggtcgaacagcc ctccatcttgcagtggacctgcagaattctgacctcgtgtcactcttgttgaagtgcggg gctgacgtcaaccgagtcacctaccagggctactccccataccagctcacctggggccgc ccaagcacgcggatacagcagcagctgggccagctgaccctagaaaaccttcagatgctg ccggagagtgaggatgaggagagctacgacacggagtcagagttcacggaagacgagcta ccctatgatgactgtgtgcttggaggccagcgcctgacgttatga

DBGET integrated database retrieval system