Ursus americanus (American black bear): 123794226 Help Entry 123794226         CDS       T07931                                  Name (RefSeq) histone H2B type 2-E-like   KO K11252   histone H2B Organism uar  Ursus americanus (American black bear) Pathway uar04613   Neutrophil extracellular trap formation uar05034   Alcoholism uar05203   Viral carcinogenesis uar05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:uar00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     123794226  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     123794226   09163 Immune disease    05322 Systemic lupus erythematosus     123794226   09165 Substance dependence    05034 Alcoholism     123794226  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:uar03036]     123794226   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:uar04147]     123794226 Chromosome and associated proteins [BR:uar03036]  Eukaryotic type   Nucleosome assembly factors    Histones     123794226 Exosome [BR:uar04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    123794226 SSDB OrthologParalogGFIT Motif Pfam:  Histone Histone_ABTB CBFD_NFYB_HMF TFIID_20kDa YscO-like Motif Other DBs NCBI-GeneID:  123794226 NCBI-ProteinID:  XP_045656413 UniProt:  A0A452R775 LinkDB All DBs Position Unknown AA seq 126 aa AA seqDB search MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRGRKESYSIYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSSK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgccagagcctgctaagtcagccccagcccccaaaaagggctctaagaaggcggtgacc aaggcgcagaaaaaggacggcaagaaacgcaaacgcggccgcaaagagagctattccatc tacgtgtacaaggtgctgaagcaggtgcaccccgacaccggcatctcgtccaaggccatg ggcatcatgaactcgttcgtcaacgacatcttcgagcgcatcgcgggcgaggcgtcgcgc ctggcgcattacaacaagcgctcgaccatcacgtccagagagatccagacggccgtgcgc ctgctgctgcccggggagctggccaagcacgccgtgtccgagggcaccaaggccgtcacc aagtacaccagctccaagtaa

DBGET integrated database retrieval system