Ursus americanus (American black bear): 123794245 Help Entry 123794245         CDS       T07931                                  Name (RefSeq) histone H2B type 1-A   KO K11252   histone H2B Organism uar  Ursus americanus (American black bear) Pathway uar04613   Neutrophil extracellular trap formation uar05034   Alcoholism uar05203   Viral carcinogenesis uar05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:uar00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     123794245  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     123794245   09163 Immune disease    05322 Systemic lupus erythematosus     123794245   09165 Substance dependence    05034 Alcoholism     123794245  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:uar03036]     123794245   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:uar04147]     123794245 Chromosome and associated proteins [BR:uar03036]  Eukaryotic type   Nucleosome assembly factors    Histones     123794245 Exosome [BR:uar04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    123794245 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa ARM_TT21 CvfB_WH Motif Other DBs NCBI-GeneID:  123794245 NCBI-ProteinID:  XP_045656433 UniProt:  A0A452RSG3 LinkDB All DBs Position Unknown AA seq 127 aa AA seqDB search MPELTSKGTTISKKGFKKAVTKTQKKEGKKRKRCRKESYSIYIYKVLKQVHPDTGISSKA MSIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAV TKYTSSK NT seq 384 nt NT seq  +upstreamnt  +downstreamnt atgccagagctgacttcgaagggcactaccatttccaagaaaggtttcaagaaagctgta accaaaactcagaagaaagaaggaaagaagcgtaagagatgccgcaaagagagctactcc atttacatctacaaggtgctgaagcaggtgcaccccgacaccggcatctcgtccaaggcc atgagcatcatgaattctttcgtcaacgacatctttgagcgcatcgcgggcgaggcgtcg cgcctggcgcattacaacaagcgctcgaccatcacgtccagggagatccagacggccgtg cgcctgctgctgcctggggagctggctaaacacgccgtgtctgagggcaccaaggccgtc accaagtacaccagctccaagtaa

DBGET integrated database retrieval system