Ursus americanus (American black bear): 123795037 Help Entry 123795037         CDS       T07931                                  Symbol NRAS Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism uar  Ursus americanus (American black bear) Pathway uar01521   EGFR tyrosine kinase inhibitor resistance uar01522   Endocrine resistance uar04010   MAPK signaling pathway uar04012   ErbB signaling pathway uar04014   Ras signaling pathway uar04015   Rap1 signaling pathway uar04062   Chemokine signaling pathway uar04068   FoxO signaling pathway uar04071   Sphingolipid signaling pathway uar04072   Phospholipase D signaling pathway uar04137   Mitophagy - animal uar04140   Autophagy - animal uar04150   mTOR signaling pathway uar04151   PI3K-Akt signaling pathway uar04210   Apoptosis uar04211   Longevity regulating pathway uar04213   Longevity regulating pathway - multiple species uar04218   Cellular senescence uar04360   Axon guidance uar04370   VEGF signaling pathway uar04371   Apelin signaling pathway uar04540   Gap junction uar04550   Signaling pathways regulating pluripotency of stem cells uar04625   C-type lectin receptor signaling pathway uar04650   Natural killer cell mediated cytotoxicity uar04660   T cell receptor signaling pathway uar04662   B cell receptor signaling pathway uar04664   Fc epsilon RI signaling pathway uar04714   Thermogenesis uar04720   Long-term potentiation uar04722   Neurotrophin signaling pathway uar04725   Cholinergic synapse uar04726   Serotonergic synapse uar04730   Long-term depression uar04810   Regulation of actin cytoskeleton uar04910   Insulin signaling pathway uar04912   GnRH signaling pathway uar04915   Estrogen signaling pathway uar04916   Melanogenesis uar04917   Prolactin signaling pathway uar04919   Thyroid hormone signaling pathway uar04921   Oxytocin signaling pathway uar04926   Relaxin signaling pathway uar04929   GnRH secretion uar04933   AGE-RAGE signaling pathway in diabetic complications uar04935   Growth hormone synthesis, secretion and action uar05010   Alzheimer disease uar05022   Pathways of neurodegeneration - multiple diseases uar05034   Alcoholism uar05160   Hepatitis C uar05161   Hepatitis B uar05163   Human cytomegalovirus infection uar05165   Human papillomavirus infection uar05166   Human T-cell leukemia virus 1 infection uar05167   Kaposi sarcoma-associated herpesvirus infection uar05170   Human immunodeficiency virus 1 infection uar05200   Pathways in cancer uar05203   Viral carcinogenesis uar05205   Proteoglycans in cancer uar05206   MicroRNAs in cancer uar05207   Chemical carcinogenesis - receptor activation uar05208   Chemical carcinogenesis - reactive oxygen species uar05210   Colorectal cancer uar05211   Renal cell carcinoma uar05213   Endometrial cancer uar05214   Glioma uar05215   Prostate cancer uar05216   Thyroid cancer uar05218   Melanoma uar05219   Bladder cancer uar05220   Chronic myeloid leukemia uar05221   Acute myeloid leukemia uar05223   Non-small cell lung cancer uar05224   Breast cancer uar05225   Hepatocellular carcinoma uar05226   Gastric cancer uar05230   Central carbon metabolism in cancer uar05231   Choline metabolism in cancer uar05235   PD-L1 expression and PD-1 checkpoint pathway in cancer uar05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:uar00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     123795037 (NRAS)    04015 Rap1 signaling pathway     123795037 (NRAS)    04068 FoxO signaling pathway     123795037 (NRAS)    04072 Phospholipase D signaling pathway     123795037 (NRAS)    04071 Sphingolipid signaling pathway     123795037 (NRAS)    04151 PI3K-Akt signaling pathway     123795037 (NRAS)    04150 mTOR signaling pathway     123795037 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     123795037 (NRAS)    04137 Mitophagy - animal     123795037 (NRAS)   09144 Cellular community - eukaryotes    04550 Signaling pathways regulating pluripotency of stem cells     123795037 (NRAS)  09150 Organismal Systems   09151 Immune system    04650 Natural killer cell mediated cytotoxicity     123795037 (NRAS)    04660 T cell receptor signaling pathway     123795037 (NRAS)    04662 B cell receptor signaling pathway     123795037 (NRAS)    04664 Fc epsilon RI signaling pathway     123795037 (NRAS)    04062 Chemokine signaling pathway     123795037 (NRAS)   09152 Endocrine system    04929 GnRH secretion     123795037 (NRAS)    04915 Estrogen signaling pathway     123795037 (NRAS)    04917 Prolactin signaling pathway     123795037 (NRAS)    04921 Oxytocin signaling pathway     123795037 (NRAS)    04926 Relaxin signaling pathway     123795037 (NRAS)    04935 Growth hormone synthesis, secretion and action     123795037 (NRAS)    04919 Thyroid hormone signaling pathway     123795037 (NRAS)   09156 Nervous system    04725 Cholinergic synapse     123795037 (NRAS)    04726 Serotonergic synapse     123795037 (NRAS)    04720 Long-term potentiation     123795037 (NRAS)    04730 Long-term depression     123795037 (NRAS)    04722 Neurotrophin signaling pathway     123795037 (NRAS)   09158 Development and regeneration    04360 Axon guidance     123795037 (NRAS)   09149 Aging    04211 Longevity regulating pathway     123795037 (NRAS)    04213 Longevity regulating pathway - multiple species     123795037 (NRAS)   09159 Environmental adaptation    04714 Thermogenesis     123795037 (NRAS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     123795037 (NRAS)    05206 MicroRNAs in cancer     123795037 (NRAS)    05205 Proteoglycans in cancer     123795037 (NRAS)    05207 Chemical carcinogenesis - receptor activation     123795037 (NRAS)    05208 Chemical carcinogenesis - reactive oxygen species     123795037 (NRAS)    05203 Viral carcinogenesis     123795037 (NRAS)    05230 Central carbon metabolism in cancer     123795037 (NRAS)    05231 Choline metabolism in cancer     123795037 (NRAS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     123795037 (NRAS)   09162 Cancer: specific types    05210 Colorectal cancer     123795037 (NRAS)    05225 Hepatocellular carcinoma     123795037 (NRAS)    05226 Gastric cancer     123795037 (NRAS)    05214 Glioma     123795037 (NRAS)    05216 Thyroid cancer     123795037 (NRAS)    05221 Acute myeloid leukemia     123795037 (NRAS)    05220 Chronic myeloid leukemia     123795037 (NRAS)    05218 Melanoma     123795037 (NRAS)    05211 Renal cell carcinoma     123795037 (NRAS)    05219 Bladder cancer     123795037 (NRAS)    05215 Prostate cancer     123795037 (NRAS)    05213 Endometrial cancer     123795037 (NRAS)    05224 Breast cancer     123795037 (NRAS)    05223 Non-small cell lung cancer     123795037 (NRAS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     123795037 (NRAS)    05170 Human immunodeficiency virus 1 infection     123795037 (NRAS)    05161 Hepatitis B     123795037 (NRAS)    05160 Hepatitis C     123795037 (NRAS)    05163 Human cytomegalovirus infection     123795037 (NRAS)    05167 Kaposi sarcoma-associated herpesvirus infection     123795037 (NRAS)    05165 Human papillomavirus infection     123795037 (NRAS)   09164 Neurodegenerative disease    05010 Alzheimer disease     123795037 (NRAS)    05022 Pathways of neurodegeneration - multiple diseases     123795037 (NRAS)   09165 Substance dependence    05034 Alcoholism     123795037 (NRAS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     123795037 (NRAS)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     123795037 (NRAS)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     123795037 (NRAS)    01522 Endocrine resistance     123795037 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:uar04131]     123795037 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:uar04147]     123795037 (NRAS)    04031 GTP-binding proteins [BR:uar04031]     123795037 (NRAS) Membrane trafficking [BR:uar04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     123795037 (NRAS)  Endocytosis   Macropinocytosis    Ras GTPases     123795037 (NRAS) Exosome [BR:uar04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    123795037 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    123795037 (NRAS)   Exosomal proteins of breast cancer cells    123795037 (NRAS)   Exosomal proteins of colorectal cancer cells    123795037 (NRAS) GTP-binding proteins [BR:uar04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     123795037 (NRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N Motif Other DBs NCBI-GeneID:  123795037 NCBI-ProteinID:  XP_045657400 LinkDB All DBs Position Unknown AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG CMGLPCVVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgactgagtacaaactggtggtggttggagcaggtggtgtcgggaaaagcgcactgaca atccagctaatccagaaccactttgtagatgaatatgatcccaccatagaggattcttac cgaaaacaggtggttatagacggtgaaacctgtctgttggacatactggatacagctggt caagaggagtacagtgccatgagagaccaatacatgaggacaggcgaaggtttcctctgt gtatttgccatcaataatagcaaatcatttgcagatattaacctctacagggaacagatt aagcgagtcaaagattcagatgacgtacctatggtgctagtaggaaataagtgtgatttg ccaacaaggacagtggacacaaaacaagcccacgaactggccaagagttatgggattcca ttcattgaaacctcagccaagaccagacagggtgttgaagatgccttttacacactggta agagaaatacgtcagtaccgaatgaagaaactcaacagcagtgatgatgggactcaaggt tgtatggggttaccatgtgtggtgatgtaa

DBGET integrated database retrieval system