Ursus americanus (American black bear): 123795376 Help Entry 123795376         CDS       T07931                                  Symbol JUN Name (RefSeq) transcription factor AP-1   KO K04448   transcription factor AP-1 Organism uar  Ursus americanus (American black bear) Pathway uar01522   Endocrine resistance uar04010   MAPK signaling pathway uar04012   ErbB signaling pathway uar04024   cAMP signaling pathway uar04137   Mitophagy - animal uar04210   Apoptosis uar04310   Wnt signaling pathway uar04380   Osteoclast differentiation uar04510   Focal adhesion uar04530   Tight junction uar04620   Toll-like receptor signaling pathway uar04621   NOD-like receptor signaling pathway uar04625   C-type lectin receptor signaling pathway uar04657   IL-17 signaling pathway uar04658   Th1 and Th2 cell differentiation uar04659   Th17 cell differentiation uar04660   T cell receptor signaling pathway uar04662   B cell receptor signaling pathway uar04668   TNF signaling pathway uar04722   Neurotrophin signaling pathway uar04912   GnRH signaling pathway uar04915   Estrogen signaling pathway uar04921   Oxytocin signaling pathway uar04926   Relaxin signaling pathway uar04932   Non-alcoholic fatty liver disease uar04933   AGE-RAGE signaling pathway in diabetic complications uar05030   Cocaine addiction uar05031   Amphetamine addiction uar05132   Salmonella infection uar05133   Pertussis uar05135   Yersinia infection uar05140   Leishmaniasis uar05142   Chagas disease uar05161   Hepatitis B uar05162   Measles uar05166   Human T-cell leukemia virus 1 infection uar05167   Kaposi sarcoma-associated herpesvirus infection uar05169   Epstein-Barr virus infection uar05170   Human immunodeficiency virus 1 infection uar05171   Coronavirus disease - COVID-19 uar05200   Pathways in cancer uar05203   Viral carcinogenesis uar05207   Chemical carcinogenesis - receptor activation uar05208   Chemical carcinogenesis - reactive oxygen species uar05210   Colorectal cancer uar05211   Renal cell carcinoma uar05224   Breast cancer uar05231   Choline metabolism in cancer uar05235   PD-L1 expression and PD-1 checkpoint pathway in cancer uar05321   Inflammatory bowel disease uar05323   Rheumatoid arthritis uar05417   Lipid and atherosclerosis uar05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:uar00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     123795376 (JUN)    04012 ErbB signaling pathway     123795376 (JUN)    04310 Wnt signaling pathway     123795376 (JUN)    04668 TNF signaling pathway     123795376 (JUN)    04024 cAMP signaling pathway     123795376 (JUN)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     123795376 (JUN)   09143 Cell growth and death    04210 Apoptosis     123795376 (JUN)   09144 Cellular community - eukaryotes    04510 Focal adhesion     123795376 (JUN)    04530 Tight junction     123795376 (JUN)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     123795376 (JUN)    04621 NOD-like receptor signaling pathway     123795376 (JUN)    04625 C-type lectin receptor signaling pathway     123795376 (JUN)    04660 T cell receptor signaling pathway     123795376 (JUN)    04658 Th1 and Th2 cell differentiation     123795376 (JUN)    04659 Th17 cell differentiation     123795376 (JUN)    04657 IL-17 signaling pathway     123795376 (JUN)    04662 B cell receptor signaling pathway     123795376 (JUN)   09152 Endocrine system    04912 GnRH signaling pathway     123795376 (JUN)    04915 Estrogen signaling pathway     123795376 (JUN)    04921 Oxytocin signaling pathway     123795376 (JUN)    04926 Relaxin signaling pathway     123795376 (JUN)   09156 Nervous system    04722 Neurotrophin signaling pathway     123795376 (JUN)   09158 Development and regeneration    04380 Osteoclast differentiation     123795376 (JUN)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     123795376 (JUN)    05207 Chemical carcinogenesis - receptor activation     123795376 (JUN)    05208 Chemical carcinogenesis - reactive oxygen species     123795376 (JUN)    05203 Viral carcinogenesis     123795376 (JUN)    05231 Choline metabolism in cancer     123795376 (JUN)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     123795376 (JUN)   09162 Cancer: specific types    05210 Colorectal cancer     123795376 (JUN)    05211 Renal cell carcinoma     123795376 (JUN)    05224 Breast cancer     123795376 (JUN)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     123795376 (JUN)    05170 Human immunodeficiency virus 1 infection     123795376 (JUN)    05161 Hepatitis B     123795376 (JUN)    05171 Coronavirus disease - COVID-19     123795376 (JUN)    05162 Measles     123795376 (JUN)    05167 Kaposi sarcoma-associated herpesvirus infection     123795376 (JUN)    05169 Epstein-Barr virus infection     123795376 (JUN)   09171 Infectious disease: bacterial    05132 Salmonella infection     123795376 (JUN)    05135 Yersinia infection     123795376 (JUN)    05133 Pertussis     123795376 (JUN)   09174 Infectious disease: parasitic    05140 Leishmaniasis     123795376 (JUN)    05142 Chagas disease     123795376 (JUN)   09163 Immune disease    05323 Rheumatoid arthritis     123795376 (JUN)    05321 Inflammatory bowel disease     123795376 (JUN)   09165 Substance dependence    05030 Cocaine addiction     123795376 (JUN)    05031 Amphetamine addiction     123795376 (JUN)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     123795376 (JUN)    05418 Fluid shear stress and atherosclerosis     123795376 (JUN)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     123795376 (JUN)    04933 AGE-RAGE signaling pathway in diabetic complications     123795376 (JUN)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     123795376 (JUN)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:uar03000]     123795376 (JUN) Transcription factors [BR:uar03000]  Eukaryotic type   Basic leucine zipper (bZIP)    AP-1(-like) components, Jun     123795376 (JUN) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Jun bZIP_1 bZIP_2 bZIP_Maf ZapB PspA_IM30 Fib_alpha DUF3450 FlaC_arch TFIIA Motif Other DBs NCBI-GeneID:  123795376 NCBI-ProteinID:  XP_045658176 UniProt:  A0A452QTV2 LinkDB All DBs Position Unknown AA seq 334 aa AA seqDB search MTAKMETTFYDDALNASFLQSESGAYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDL LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE LHSQNTLPSVTSAAQPVSGAGMVAPAVASAAGGSGSGGFSASLHSEPPVYANLSNFNPGA LSSGGGAPSYGAAGLAFPAQPQQQQQPPQPPHHLPQQIPVQHPRLQALKEEPQTVPEMPG ETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELAST ANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt atgactgcaaagatggaaacgaccttctacgacgatgccctcaacgcctcgttcctccag tccgagagcggcgcctacggctacagtaaccccaagatcctgaaacagagcatgaccctg aacctggccgacccggtgggcagcctgaagccgcacctccgggccaagaactcggacctc ctcacctcgcccgacgtggggctgctcaagctggcgtcgcccgagctggagcgcctgata atccagtccagcaacgggcacatcaccactacgccgacccccacgcagttcctgtgcccc aagaacgtgacagacgagcaggagggcttcgccgagggtttcgtgcgcgccctggccgaa ctgcacagccagaacacgctgcccagcgtcacgtctgcggcgcagccggtcagcggggcg ggcatggtggctccggcggtggcttcggcggcaggcggcagcggcagcggcggcttcagc gccagcctgcacagcgagccgccggtctacgccaacctcagcaacttcaaccccggcgcg ctgagcagcggcggcggggcgccctcctacggcgcggccggcctggcctttcccgcgcag ccccagcagcagcagcagcccccgcagccgccgcaccacctgccgcagcagatccccgtg cagcacccgcggcttcaggccttgaaggaggagccgcagacggtgcccgagatgcccggg gaaacgccgcccctgtcccccatcgacatggagtcgcaggagaggatcaaggcggagagg aagcgcatgaggaaccgcatagctgcctccaagtgccggaaaaggaagctggagaggatc gccaggctggaggaaaaagtgaaaaccttgaaagcgcagaactcggagctggcgtccacg gccaacatgctcagggaacaggtggcacagcttaaacagaaagtcatgaaccacgttaac agtgggtgccaactcatgctaacgcagcagttgcaaacgttttga

DBGET integrated database retrieval system