Ursus americanus (American black bear): 123796079 Help Entry 123796079         CDS       T07931                                  Symbol CALML6 Name (RefSeq) calmodulin-like protein 6   KO K02183   calmodulin Organism uar  Ursus americanus (American black bear) Pathway uar04014   Ras signaling pathway uar04015   Rap1 signaling pathway uar04020   Calcium signaling pathway uar04022   cGMP-PKG signaling pathway uar04024   cAMP signaling pathway uar04070   Phosphatidylinositol signaling system uar04114   Oocyte meiosis uar04218   Cellular senescence uar04261   Adrenergic signaling in cardiomyocytes uar04270   Vascular smooth muscle contraction uar04371   Apelin signaling pathway uar04625   C-type lectin receptor signaling pathway uar04713   Circadian entrainment uar04720   Long-term potentiation uar04722   Neurotrophin signaling pathway uar04728   Dopaminergic synapse uar04740   Olfactory transduction uar04744   Phototransduction uar04750   Inflammatory mediator regulation of TRP channels uar04910   Insulin signaling pathway uar04912   GnRH signaling pathway uar04915   Estrogen signaling pathway uar04916   Melanogenesis uar04921   Oxytocin signaling pathway uar04922   Glucagon signaling pathway uar04924   Renin secretion uar04925   Aldosterone synthesis and secretion uar04970   Salivary secretion uar04971   Gastric acid secretion uar05010   Alzheimer disease uar05012   Parkinson disease uar05022   Pathways of neurodegeneration - multiple diseases uar05031   Amphetamine addiction uar05034   Alcoholism uar05133   Pertussis uar05152   Tuberculosis uar05163   Human cytomegalovirus infection uar05167   Kaposi sarcoma-associated herpesvirus infection uar05170   Human immunodeficiency virus 1 infection uar05200   Pathways in cancer uar05214   Glioma uar05417   Lipid and atherosclerosis uar05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:uar00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     123796079 (CALML6)    04015 Rap1 signaling pathway     123796079 (CALML6)    04070 Phosphatidylinositol signaling system     123796079 (CALML6)    04024 cAMP signaling pathway     123796079 (CALML6)    04022 cGMP-PKG signaling pathway     123796079 (CALML6)  09150 Organismal Systems   09152 Endocrine system    04922 Glucagon signaling pathway     123796079 (CALML6)    04915 Estrogen signaling pathway     123796079 (CALML6)    04921 Oxytocin signaling pathway     123796079 (CALML6)    04924 Renin secretion     123796079 (CALML6)    04925 Aldosterone synthesis and secretion     123796079 (CALML6)   09154 Digestive system    04970 Salivary secretion     123796079 (CALML6)    04971 Gastric acid secretion     123796079 (CALML6)   09156 Nervous system    04728 Dopaminergic synapse     123796079 (CALML6)    04720 Long-term potentiation     123796079 (CALML6)    04722 Neurotrophin signaling pathway     123796079 (CALML6)   09157 Sensory system    04740 Olfactory transduction     123796079 (CALML6)    04750 Inflammatory mediator regulation of TRP channels     123796079 (CALML6)   09159 Environmental adaptation    04713 Circadian entrainment     123796079 (CALML6)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     123796079 (CALML6)   09162 Cancer: specific types    05214 Glioma     123796079 (CALML6)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     123796079 (CALML6)    05163 Human cytomegalovirus infection     123796079 (CALML6)    05167 Kaposi sarcoma-associated herpesvirus infection     123796079 (CALML6)   09171 Infectious disease: bacterial    05133 Pertussis     123796079 (CALML6)    05152 Tuberculosis     123796079 (CALML6)   09164 Neurodegenerative disease    05010 Alzheimer disease     123796079 (CALML6)    05012 Parkinson disease     123796079 (CALML6)    05022 Pathways of neurodegeneration - multiple diseases     123796079 (CALML6)   09165 Substance dependence    05031 Amphetamine addiction     123796079 (CALML6)    05034 Alcoholism     123796079 (CALML6)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     123796079 (CALML6)    05418 Fluid shear stress and atherosclerosis     123796079 (CALML6)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:uar01009]     123796079 (CALML6)   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:uar04131]     123796079 (CALML6)    03036 Chromosome and associated proteins [BR:uar03036]     123796079 (CALML6)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:uar04147]     123796079 (CALML6) Protein phosphatases and associated proteins [BR:uar01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      123796079 (CALML6) Membrane trafficking [BR:uar04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     123796079 (CALML6) Chromosome and associated proteins [BR:uar03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      123796079 (CALML6) Exosome [BR:uar04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    123796079 (CALML6) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 AIF-1 EF-hand_9 EF-hand_5 EH EFhand_Ca_insen Motif Other DBs NCBI-GeneID:  123796079 NCBI-ProteinID:  XP_045659331 LinkDB All DBs Position Unknown AA seq 220 aa AA seqDB search MTLKAVSSRRAGTERPSPELGKQDRSLKGCQVDGQGGVPCVLGPPTFLGLRGRGGPGEAG PVSLQTERLTAEQIKEYKGVFEMFDEEGNGEVKTGELERLMSLLGINPTKSELASMAKDV DRDNKGFFNCDSFLALMGIYWEKAQNQEGELRAAFRVFDKEGKGYIDWDTLKYVLMNAGE PLNEVEAEQMMKEADKDGDGTIDYEEFVAMMTGESFKLVQ NT seq 663 nt NT seq  +upstreamnt  +downstreamnt atgacgctcaaggccgtttccagcaggcgggcaggcactgagcggccttccccggagctg gggaagcaggacagatccctgaagggttgccaagtggatggacagggaggggtgccatgt gtgctggggcctccaaccttcctcggactgaggggcagaggaggccccggtgaagctgga ccggtgtccctgcagacggagcgcctgacagctgagcagatcaaggagtacaagggggtc tttgagatgttcgacgaggagggcaatggggaggtgaagaccggagagctggagcggctc atgagcctgttgggcatcaatcccaccaagagcgagctggcctccatggccaaggacgtg gacagagacaacaaaggattcttcaactgtgacagcttcctggccctgatggggatttac tgggaaaaggcccagaaccaggaaggcgagctgagggcagcgttccgtgtcttcgacaag gagggcaagggctacatcgactgggacacactcaagtatgtgctcatgaacgcaggtgag cccctcaatgaggtcgaggctgagcagatgatgaaggaggctgacaaggacggggatggg accatcgactacgaggagtttgtggccatgatgaccggagagtccttcaagctggtccag tag

DBGET integrated database retrieval system