Ursus americanus (American black bear): 123798367 Help Entry 123798367         CDS       T07931                                  Symbol CCL22 Name (RefSeq) C-C motif chemokine 22   KO K21095   C-C motif chemokine 22 Organism uar  Ursus americanus (American black bear) Pathway uar04060   Cytokine-cytokine receptor interaction uar04061   Viral protein interaction with cytokine and cytokine receptor uar04062   Chemokine signaling pathway uar04625   C-type lectin receptor signaling pathway Brite KEGG Orthology (KO) [BR:uar00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     123798367 (CCL22)    04061 Viral protein interaction with cytokine and cytokine receptor     123798367 (CCL22)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     123798367 (CCL22)    04062 Chemokine signaling pathway     123798367 (CCL22)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:uar04052]     123798367 (CCL22) Cytokines and neuropeptides [BR:uar04052]  Cytokines   Chemokines    123798367 (CCL22) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  123798367 NCBI-ProteinID:  XP_045662672 UniProt:  A0A452RR14 LinkDB All DBs Position Unknown AA seq 93 aa AA seqDB search MASLKTPLLAALVFLALILQATEAGPYGANVEDSICCRDYFRHPLPLRMLKFFYWTSDSC RRPGVVFLTVKDREICADPRMPWVKKILQKLDQ NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atggccagcctgaagactccgctcctggctgcccttgtcttccttgctctgatacttcaa gcaactgaggcaggtccttacggcgccaacgtggaggacagcatctgctgccgggactac ttccgtcaccctctgcccctgcgcatgctgaagtttttctactggacctcggactcgtgc cggcggcccggcgtggtcttcctaactgtcaaggaccgggagatctgtgctgaccccaga atgccctgggtgaagaagattctccagaaactggaccaatga

DBGET integrated database retrieval system