Ursus americanus (American black bear): 123798690 Help Entry 123798690         CDS       T07931                                  Symbol BCL2L1 Name (RefSeq) bcl-2-like protein 1   KO K04570   Bcl-2-like 1 (apoptosis regulator Bcl-X) Organism uar  Ursus americanus (American black bear) Pathway uar01521   EGFR tyrosine kinase inhibitor resistance uar01524   Platinum drug resistance uar04014   Ras signaling pathway uar04064   NF-kappa B signaling pathway uar04115   p53 signaling pathway uar04137   Mitophagy - animal uar04140   Autophagy - animal uar04151   PI3K-Akt signaling pathway uar04210   Apoptosis uar04215   Apoptosis - multiple species uar04621   NOD-like receptor signaling pathway uar04630   JAK-STAT signaling pathway uar05012   Parkinson disease uar05014   Amyotrophic lateral sclerosis uar05022   Pathways of neurodegeneration - multiple diseases uar05145   Toxoplasmosis uar05162   Measles uar05166   Human T-cell leukemia virus 1 infection uar05168   Herpes simplex virus 1 infection uar05170   Human immunodeficiency virus 1 infection uar05200   Pathways in cancer uar05202   Transcriptional misregulation in cancer uar05212   Pancreatic cancer uar05220   Chronic myeloid leukemia uar05222   Small cell lung cancer uar05225   Hepatocellular carcinoma uar05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:uar00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     123798690 (BCL2L1)    04630 JAK-STAT signaling pathway     123798690 (BCL2L1)    04064 NF-kappa B signaling pathway     123798690 (BCL2L1)    04151 PI3K-Akt signaling pathway     123798690 (BCL2L1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     123798690 (BCL2L1)    04137 Mitophagy - animal     123798690 (BCL2L1)   09143 Cell growth and death    04210 Apoptosis     123798690 (BCL2L1)    04215 Apoptosis - multiple species     123798690 (BCL2L1)    04115 p53 signaling pathway     123798690 (BCL2L1)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     123798690 (BCL2L1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     123798690 (BCL2L1)    05202 Transcriptional misregulation in cancer     123798690 (BCL2L1)   09162 Cancer: specific types    05212 Pancreatic cancer     123798690 (BCL2L1)    05225 Hepatocellular carcinoma     123798690 (BCL2L1)    05220 Chronic myeloid leukemia     123798690 (BCL2L1)    05222 Small cell lung cancer     123798690 (BCL2L1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     123798690 (BCL2L1)    05170 Human immunodeficiency virus 1 infection     123798690 (BCL2L1)    05162 Measles     123798690 (BCL2L1)    05168 Herpes simplex virus 1 infection     123798690 (BCL2L1)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     123798690 (BCL2L1)   09164 Neurodegenerative disease    05012 Parkinson disease     123798690 (BCL2L1)    05014 Amyotrophic lateral sclerosis     123798690 (BCL2L1)    05022 Pathways of neurodegeneration - multiple diseases     123798690 (BCL2L1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     123798690 (BCL2L1)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     123798690 (BCL2L1)    01524 Platinum drug resistance     123798690 (BCL2L1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:uar01009]     123798690 (BCL2L1)   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:uar03036]     123798690 (BCL2L1)   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:uar02000]     123798690 (BCL2L1) Protein phosphatases and associated proteins [BR:uar01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      123798690 (BCL2L1) Chromosome and associated proteins [BR:uar03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     123798690 (BCL2L1) Transporters [BR:uar02000]  Other transporters   Pores ion channels [TC:1]    123798690 (BCL2L1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 Motif Other DBs NCBI-GeneID:  123798690 NCBI-ProteinID:  XP_045663153 UniProt:  A0A452SDS4 LinkDB All DBs Position Unknown AA seq 233 aa AA seqDB search MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLA DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIATWMATYLNDHLEP WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK NT seq 702 nt NT seq  +upstreamnt  +downstreamnt atgtctcagagcaaccgggagctggtggttgactttctctcctacaagctttcccagaaa ggatacagctggagtcagtttagtgatgtggaagagaacagaactgaggccccagaagga actgaatcagagatggagacccccagtgccatcaatggcaacccatcctggcacttggcg gacagccctgcggtgaatggagccactggccacagcagcagcttggatgcccgggaggtg atccccatggcagcagtgaagcaagcgctgagggaggccggggatgagttcgaactgagg taccggcgggcattcagcgacctgacatcccagcttcacatcaccccagggacagcgtat cagagctttgagcaggtagtgaatgaactcttccgggatggggtgaactggggtcgcatt gtggcctttttctccttcggtggggcattgtgcgtggagagcgtagacaaggagatgcag gtattggtgagtcggatcgcaacttggatggccacttacctgaacgaccacctagagcct tggatccaggagaacggcggctgggacactttcgtggaactctacgggaacaatgcagcg gctgaaagccggaagggccaggagcgcttcaaccgctggttcctgacaggcatgactgtg gctggcgtggttctgctgggctcgctcttcagtcggaaatga

DBGET integrated database retrieval system