Ursus americanus (American black bear): 123800908 Help Entry 123800908         CDS       T07931                                  Symbol DEFB1 Name (RefSeq) beta-defensin 1   KO K23125   beta-defensin 1 Organism uar  Ursus americanus (American black bear) Pathway uar02010   ABC transporters uar05150   Staphylococcus aureus infection Brite KEGG Orthology (KO) [BR:uar00001]  09130 Environmental Information Processing   09131 Membrane transport    02010 ABC transporters     123800908 (DEFB1)  09160 Human Diseases   09171 Infectious disease: bacterial    05150 Staphylococcus aureus infection     123800908 (DEFB1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:uar02000]     123800908 (DEFB1)    03037 Cilium and associated proteins [BR:uar03037]     123800908 (DEFB1) Transporters [BR:uar02000]  Other transporters   Pores ion channels [TC:1]    123800908 (DEFB1) Cilium and associated proteins [BR:uar03037]  Motile cilia and associated proteins   Sperm associated proteins    123800908 (DEFB1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Defensin_beta Defb50 Motif Other DBs NCBI-GeneID:  123800908 NCBI-ProteinID:  XP_045666819 LinkDB All DBs Position Unknown AA seq 68 aa AA seqDB search MRVLSFLLILGVLFSHLAPGAGYLTGFGQRSDHYVCARRGGTCNFSPCPLFTRVDGTCYG GKAKCCMR NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atgagggttctctccttcctgctgattctgggcgtgctcttctcccacctggccccaggt gctggctaccttacaggtttcggccagaggtcagaccactatgtctgtgccaggagagga ggcacctgtaacttttccccgtgcccgctcttcaccagggtggacggcacctgttacggc gggaaggccaagtgctgcatgcgttga

DBGET integrated database retrieval system