KEGG   Ursus americanus (American black bear): 123802291
Entry
123802291         CDS       T07931                                 
Name
(RefSeq) calmodulin-like
  KO
K02183  calmodulin
Organism
uar  Ursus americanus (American black bear)
Pathway
uar04014  Ras signaling pathway
uar04015  Rap1 signaling pathway
uar04020  Calcium signaling pathway
uar04022  cGMP-PKG signaling pathway
uar04024  cAMP signaling pathway
uar04070  Phosphatidylinositol signaling system
uar04114  Oocyte meiosis
uar04218  Cellular senescence
uar04261  Adrenergic signaling in cardiomyocytes
uar04270  Vascular smooth muscle contraction
uar04371  Apelin signaling pathway
uar04625  C-type lectin receptor signaling pathway
uar04713  Circadian entrainment
uar04720  Long-term potentiation
uar04722  Neurotrophin signaling pathway
uar04728  Dopaminergic synapse
uar04740  Olfactory transduction
uar04744  Phototransduction
uar04750  Inflammatory mediator regulation of TRP channels
uar04910  Insulin signaling pathway
uar04912  GnRH signaling pathway
uar04915  Estrogen signaling pathway
uar04916  Melanogenesis
uar04921  Oxytocin signaling pathway
uar04922  Glucagon signaling pathway
uar04924  Renin secretion
uar04925  Aldosterone synthesis and secretion
uar04970  Salivary secretion
uar04971  Gastric acid secretion
uar05010  Alzheimer disease
uar05012  Parkinson disease
uar05022  Pathways of neurodegeneration - multiple diseases
uar05031  Amphetamine addiction
uar05034  Alcoholism
uar05133  Pertussis
uar05152  Tuberculosis
uar05163  Human cytomegalovirus infection
uar05167  Kaposi sarcoma-associated herpesvirus infection
uar05170  Human immunodeficiency virus 1 infection
uar05200  Pathways in cancer
uar05214  Glioma
uar05417  Lipid and atherosclerosis
uar05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:uar00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    123802291
   04015 Rap1 signaling pathway
    123802291
   04371 Apelin signaling pathway
    123802291
   04020 Calcium signaling pathway
    123802291
   04070 Phosphatidylinositol signaling system
    123802291
   04024 cAMP signaling pathway
    123802291
   04022 cGMP-PKG signaling pathway
    123802291
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    123802291
   04218 Cellular senescence
    123802291
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    123802291
  09152 Endocrine system
   04910 Insulin signaling pathway
    123802291
   04922 Glucagon signaling pathway
    123802291
   04912 GnRH signaling pathway
    123802291
   04915 Estrogen signaling pathway
    123802291
   04921 Oxytocin signaling pathway
    123802291
   04916 Melanogenesis
    123802291
   04924 Renin secretion
    123802291
   04925 Aldosterone synthesis and secretion
    123802291
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    123802291
   04270 Vascular smooth muscle contraction
    123802291
  09154 Digestive system
   04970 Salivary secretion
    123802291
   04971 Gastric acid secretion
    123802291
  09156 Nervous system
   04728 Dopaminergic synapse
    123802291
   04720 Long-term potentiation
    123802291
   04722 Neurotrophin signaling pathway
    123802291
  09157 Sensory system
   04744 Phototransduction
    123802291
   04740 Olfactory transduction
    123802291
   04750 Inflammatory mediator regulation of TRP channels
    123802291
  09159 Environmental adaptation
   04713 Circadian entrainment
    123802291
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    123802291
  09162 Cancer: specific types
   05214 Glioma
    123802291
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    123802291
   05163 Human cytomegalovirus infection
    123802291
   05167 Kaposi sarcoma-associated herpesvirus infection
    123802291
  09171 Infectious disease: bacterial
   05133 Pertussis
    123802291
   05152 Tuberculosis
    123802291
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    123802291
   05012 Parkinson disease
    123802291
   05022 Pathways of neurodegeneration - multiple diseases
    123802291
  09165 Substance dependence
   05031 Amphetamine addiction
    123802291
   05034 Alcoholism
    123802291
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    123802291
   05418 Fluid shear stress and atherosclerosis
    123802291
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:uar01009]
    123802291
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:uar04131]
    123802291
   03036 Chromosome and associated proteins [BR:uar03036]
    123802291
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:uar04147]
    123802291
Protein phosphatases and associated proteins [BR:uar01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     123802291
Membrane trafficking [BR:uar04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    123802291
Chromosome and associated proteins [BR:uar03036]
 Eukaryotic type
  Centrosome formation proteins
   Centrosome duplication proteins
    Centriole replication proteins
     123802291
Exosome [BR:uar04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   123802291
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 AIF-1 EF-hand_9 EF-hand_FSTL1 EH EF_EFCAB10_C SPARC_Ca_bdg Dockerin_1 EF-hand_EFHB_C EF-hand_11 UPF0154 FCaBP_EF-hand EF-hand_STIM1 TerB SAPC2_N DUF5580_M Tsc35 USP32_N Phage_TAC_12 SUB1_ProdP9 SurA_N_3
Other DBs
NCBI-GeneID: 123802291
NCBI-ProteinID: XP_045668840
LinkDB
Position
Unknown
AA seq 149 aa
MAEQLSEEQVAEFKAAFSRFDTNGDGTINTQELGAVMRDLGEDLSEDELKKLIALVDTDG
DGVISFQEFLAEMVKRMKSWGSEHDMREVFRAFDLDGNGHISVDELKQAMATLGEKLSQE
ELDAMIQEADVDKDGQVNYEEFLRILSQK
NT seq 450 nt   +upstreamnt  +downstreamnt
atggccgagcagctgtctgaagaacaggtggccgagttcaaggcggctttctccagattt
gacacgaacggggatggcaccatcaacacccaggagctgggcgccgtgatgcgggacctg
ggcgaggatctgtcggaagacgagctgaagaaactcatcgcactggtggacacggatggc
gacggtgtcatcagcttccaagagttcctggcagagatggtcaagaggatgaagtcctgg
ggcagcgagcacgacatgcgggaggtcttccgtgccttcgacctggacggcaatggccac
atcagtgtggacgagctcaaacaggccatggccacactgggcgagaagctttcccaggag
gagctggacgccatgatccaggaggccgacgtggacaaggacgggcaggtgaactacgag
gagttcttgcgcatcctctcccagaagtga

DBGET integrated database retrieval system