Ursus americanus (American black bear): 804842 Help Entry 804842            CDS       T07931                                  Symbol ND4L Name (RefSeq) NADH dehydrogenase subunit 4L   KO K03882   NADH-ubiquinone oxidoreductase chain 4L [EC:7.1.1.2] Organism uar  Ursus americanus (American black bear) Pathway uar00190   Oxidative phosphorylation uar01100   Metabolic pathways uar04714   Thermogenesis uar04723   Retrograde endocannabinoid signaling uar05010   Alzheimer disease uar05012   Parkinson disease uar05014   Amyotrophic lateral sclerosis uar05016   Huntington disease uar05020   Prion disease uar05022   Pathways of neurodegeneration - multiple diseases uar05208   Chemical carcinogenesis - reactive oxygen species uar05415   Diabetic cardiomyopathy Module uar_M00142   NADH:ubiquinone oxidoreductase, mitochondria Brite KEGG Orthology (KO) [BR:uar00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     804842 (ND4L)  09150 Organismal Systems   09156 Nervous system    04723 Retrograde endocannabinoid signaling     804842 (ND4L)   09159 Environmental adaptation    04714 Thermogenesis     804842 (ND4L)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     804842 (ND4L)   09164 Neurodegenerative disease    05010 Alzheimer disease     804842 (ND4L)    05012 Parkinson disease     804842 (ND4L)    05014 Amyotrophic lateral sclerosis     804842 (ND4L)    05016 Huntington disease     804842 (ND4L)    05020 Prion disease     804842 (ND4L)    05022 Pathways of neurodegeneration - multiple diseases     804842 (ND4L)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     804842 (ND4L)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:uar03029]     804842 (ND4L) Enzymes [BR:uar01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.2  NADH:ubiquinone reductase (H+-translocating)      804842 (ND4L) Mitochondrial biogenesis [BR:uar03029]  Mitochondrial DNA transcription, translation, and replication factors   Mitochondrial DNA-encoded proteins    Mitochondrial respiratory chain complex I     804842 (ND4L) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Oxidored_q2 Motif Other DBs NCBI-GeneID:  804842 NCBI-ProteinID:  NP_597963 UniProt:  Q8SJJ1 I7B918 LinkDB All DBs Position MT AA seq 98 aa AA seqDB search MPVVYVNIFLAFIVSLMGLLIYRSHLMSSLLCLEGMMLSLFVMLTVTVLNNHFTLANMAP IILLVFAACEAALGLSLLVMVSNTYGTDYVQNLNLLQC NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgcctgtagtctatgtcaacattttcttagctttcatcgtgtctctaatagggctactt atttatcgatctcatctaatgtcttccctactttgcctagaaggtataatgctatcttta tttgttatgctaacagtaacagttttaaataaccatttcacactagccaacatagcccca attatcctgctggtattcgccgcctgcgaagcggcattaggattatccctgctagtaata gtctccaacacttacggaactgattacgtacaaaacctcaatctcttacaatgctaa

DBGET integrated database retrieval system