Uloborus diversus: 129220469 Help Entry 129220469         CDS       T09235                                  Name (RefSeq) ras-related protein Rab-7a-like   KO K07897   Ras-related protein Rab-7A Organism udv  Uloborus diversus Pathway udv04137   Mitophagy - animal udv04140   Autophagy - animal udv04144   Endocytosis udv04145   Phagosome udv04148   Efferocytosis Brite KEGG Orthology (KO) [BR:udv00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     129220469    04145 Phagosome     129220469    04140 Autophagy - animal     129220469    04137 Mitophagy - animal     129220469    04148 Efferocytosis     129220469  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:udv04131]     129220469   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:udv04147]     129220469    04031 GTP-binding proteins [BR:udv04031]     129220469 Membrane trafficking [BR:udv04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     129220469 Exosome [BR:udv04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    129220469   Exosomal proteins of other body fluids (saliva and urine)    129220469   Exosomal proteins of colorectal cancer cells    129220469   Exosomal proteins of bladder cancer cells    129220469 GTP-binding proteins [BR:udv04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     129220469 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  129220469 NCBI-ProteinID:  XP_054710867 LinkDB All DBs Position 1:263279752..263280213 Genome browser AA seq 153 aa AA seqDB search MIIDGEIVHLQVWDTAGQERYKSLGFSFYRGADCVLLVYDVTSPASYHSIQSWKEEFLAI SDPKDPETFPFVVVGNKIDLRKDTSCPNKIQDLMACDYEVPCFEVSALDGTGVELAFRKA AKMAMEKDFEERFFEIIPEVTCHNTNGRSKCYC NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atgattatcgatggtgaaatcgttcatcttcaagtatgggacacagctggacaagagcgt tacaaatcactgggcttttctttctacagaggtgcagactgcgtcctccttgtgtatgat gtcacatcgcctgcatcatatcattcaattcagtcatggaaggaagaatttttagccatc agcgatccgaaagatcccgaaacgtttccgttcgtcgtcgtcggcaataaaatcgatttg agaaaagacacgtcctgtccgaataagattcaggatttgatggcatgtgattatgaagta ccctgttttgaagtgagcgccctagatggaactggtgttgagctagctttccggaaagca gctaagatggccatggagaaggattttgaggagagatttttcgaaattattcctgaagtg acgtgtcacaatacaaacggccgatccaaatgctattgctaa

DBGET integrated database retrieval system