Uloborus diversus: 129231332 Help Entry 129231332         CDS       T09235                                  Name (RefSeq) ras-related protein rab7   KO K07897   Ras-related protein Rab-7A Organism udv  Uloborus diversus Pathway udv04137   Mitophagy - animal udv04140   Autophagy - animal udv04144   Endocytosis udv04145   Phagosome udv04148   Efferocytosis Brite KEGG Orthology (KO) [BR:udv00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     129231332    04145 Phagosome     129231332    04140 Autophagy - animal     129231332    04137 Mitophagy - animal     129231332    04148 Efferocytosis     129231332  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:udv04131]     129231332   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:udv04147]     129231332    04031 GTP-binding proteins [BR:udv04031]     129231332 Membrane trafficking [BR:udv04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     129231332 Exosome [BR:udv04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    129231332   Exosomal proteins of other body fluids (saliva and urine)    129231332   Exosomal proteins of colorectal cancer cells    129231332   Exosomal proteins of bladder cancer cells    129231332 GTP-binding proteins [BR:udv04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     129231332 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase ATP_bind_1 nSTAND3 DUF5992 Septin cobW AAA_16 PduV-EutP G-alpha AAA_24 AAA_7 NTPase_1 NACHT AAA_22 ATPase_2 AAA_5 AAA_14 ABC_tran SRPRB NB-ARC ATP-synt_ab PRK RNA_helicase TniB Motif Other DBs NCBI-GeneID:  129231332 NCBI-ProteinID:  XP_054721593 LinkDB All DBs Position 10:57073949..57093795 Genome browser AA seq 205 aa AA seqDB search MSSRKKVLLKVIILGDSGVGKTSLMNQFVNKKFSNQYKATIGADFLTKEIMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVYDVTAPNTFKSLDSWRDEYLIQASPRDPENFPF VVIGNKLDLENRAISTKRGQGWCQSKNNIPYFETSAKEAINVEQAFQAVAKNALSQETEV ELYNDFPDQIKLTNEQKPRSDSCAC NT seq 618 nt NT seq  +upstreamnt  +downstreamnt atgtcttctcgtaaaaaagttcttttaaaagtgatcattttgggagatagtggggttgga aaaacttctctgatgaaccagtttgtcaacaagaagttcagtaatcaatacaaagctaca ataggagcagattttttaaccaaagaaataatggttgatgatcgtctagttactatgcag atatgggatacagccggccaagaacgcttccaatcgctaggcgtggcgttttatagagga gctgactgttgtgtgcttgtgtatgatgtaacagccccaaatacttttaaatcattggat tcctggagggacgaatacctaattcaagcttcgcctcgagatcctgagaactttccattt gttgttattggaaacaaattagatctggaaaaccgagctatttcaactaaaagagggcaa ggctggtgccaaagcaaaaacaacattccatactttgaaactagtgcaaaagaagctatc aatgtggaacaagcttttcaagctgttgccaaaaatgccctatcacaagaaaccgaagtt gagttgtataatgacttcccagatcaaatcaagttgacaaatgaacagaaacccagatca gatagctgtgcttgctaa

DBGET integrated database retrieval system