Urbifossiella limnaea: ETAA1_06500 Help Entry ETAA1_06500       CDS       T07028                                  Name (GenBank) hypothetical protein   KO K02398   negative regulator of flagellin synthesis FlgM Organism uli  Urbifossiella limnaea Pathway uli02020   Two-component system uli02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:uli00001]  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     ETAA1_06500  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     ETAA1_06500  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:uli02035]     ETAA1_06500 Bacterial motility proteins [BR:uli02035]  Flagellar system   Flagellar assembly proteins    Others     ETAA1_06500 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FlgM Motif Other DBs NCBI-ProteinID:  QDU18754 UniProt:  A0A517XMM7 LinkDB All DBs Position 738653..738796 Genome browser AA seq 47 aa AA seqDB search MTATLPADGIRHDLVARVRAEIAAGTYDTDERWLVAEEALMRRASAK NT seq 144 nt NT seq  +upstreamnt  +downstreamnt atgaccgcgacgttgcccgccgacggcatccgccacgacctcgtagcccgcgtccgggcc gagatcgccgccggcacctacgacaccgacgagcgctggctcgtcgccgaagaggcgctg atgcgccgcgcttcggcgaaatga

DBGET integrated database retrieval system