Urbifossiella limnaea: ETAA1_47690 Help Entry ETAA1_47690       CDS       T07028                                  Name (GenBank) hypothetical protein   KO K03746   DNA-binding protein H-NS Organism uli  Urbifossiella limnaea Brite KEGG Orthology (KO) [BR:uli00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:uli03036]     ETAA1_47690    03400 DNA repair and recombination proteins [BR:uli03400]     ETAA1_47690 Chromosome and associated proteins [BR:uli03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     ETAA1_47690 DNA repair and recombination proteins [BR:uli03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       ETAA1_47690 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  RCDG1 DUF6203 Metal_resist Gram_pos_anchor Alpha_GJ MHYT PRIMA1 VIR_N DUF6732 Motif Other DBs NCBI-ProteinID:  QDU22781 UniProt:  A0A517XZ58 LinkDB All DBs Position 5724056..5724262 Genome browser AA seq 68 aa AA seqDB search MKIASLALLVVTLTAAAARADVRLPPPPPPPPPSTTSMETVVIGSALGLAVMGLGLWLAR RNRKVAAA NT seq 207 nt NT seq  +upstreamnt  +downstreamnt gtgaagatcgcctccctcgcgctgctggtcgtcactctcactgcggccgcggcccgggcg gacgtccgcctgccgcccccgccgcctccgccgccgccatccactacttcgatggagacg gtcgtgatcgggtcggccctcgggctggccgtcatgggcctagggctgtggctggcccgc cgaaaccggaaggtcgccgccgcatga

DBGET integrated database retrieval system