Mycosarcoma maydis: UMAG_00774 Help Entry UMAG_00774        CDS       T01021                                  Name (RefSeq) Rac1 GTP binding protein   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism uma  Mycosarcoma maydis Pathway uma04145   Phagosome uma04148   Efferocytosis uma04620   Toll-like receptor signaling pathway uma05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:uma00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     UMAG_00774    04148 Efferocytosis     UMAG_00774  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     UMAG_00774  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     UMAG_00774  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:uma04131]     UMAG_00774   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:uma04147]     UMAG_00774    04031 GTP-binding proteins [BR:uma04031]     UMAG_00774 Membrane trafficking [BR:uma04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     UMAG_00774  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     UMAG_00774   Macropinocytosis    Ras GTPases     UMAG_00774  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     UMAG_00774 Exosome [BR:uma04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    UMAG_00774   Exosomal proteins of other body fluids (saliva and urine)    UMAG_00774   Exosomal proteins of colorectal cancer cells    UMAG_00774   Exosomal proteins of bladder cancer cells    UMAG_00774 GTP-binding proteins [BR:uma04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     UMAG_00774 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  23561981 NCBI-ProteinID:  XP_011386548 UniProt:  A0A0D1EDW6 LinkDB All DBs Position 1:2314390..2315079 Genome browser AA seq 193 aa AA seqDB search MQTIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVSLGLWDTAG QEDYDRLRPLSYPQTDVFLVCFSLVSPPSFENVRTKWWPEVSHHAPNIPTILVGTKLDLR EDPETIAKLRDRRMQPITYAQGNQMARDIHATKYLECSALTQKGLKGVFDEAIRSVLAPA PVKSKKKNNCMIL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atgcagaccatcaagtgtgtagtcgtcggagacggtgccgtcggaaagacgtgtcttctt atctcgtatacaaccaacgccttcccgggcgaatacatccccacagtgtttgacaactat tcggcaaacgtcatggtcgacggtaaacccgtctctctcggtctctgggatactgcgggt caagaagactacgaccggttaagaccgctctcgtacccgcaaaccgacgtgttcctcgtg tgcttttcactggtgagtccaccttcgttcgaaaacgttcgaaccaagtggtggcccgaa gtgtcgcatcacgctcccaacattcccaccatcctcgtgggaaccaagttggatctgcgc gaggatccagagacgattgccaagctgcgcgatcgcaggatgcagcctatcacgtatgcg cagggcaatcagatggcgagggacattcacgctaccaagtatttggagtgctctgcactc acccagaagggattgaagggcgtatttgatgaagcgatcaggagcgttttggctcctgca ccagtcaagagtaagaagaagaacaactgtatgattctttaa

DBGET integrated database retrieval system