Mycosarcoma maydis: UMAG_10936 Help Entry UMAG_10936        CDS       T01021                                  Name (RefSeq) hypothetical protein   KO K03009   DNA-directed RNA polymerases I, II, and III subunit RPABC4 Organism uma  Mycosarcoma maydis Pathway uma03020   RNA polymerase uma03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:uma00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     UMAG_10936   09124 Replication and repair    03420 Nucleotide excision repair     UMAG_10936  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:uma03021]     UMAG_10936    03400 DNA repair and recombination proteins [BR:uma03400]     UMAG_10936 Transcription machinery [BR:uma03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      UMAG_10936   RNA polymerase III system    RNA polymerase III      UMAG_10936   RNA polymerase I system    RNA polymerase I      UMAG_10936 DNA repair and recombination proteins [BR:uma03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       UMAG_10936 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Zn_ribbon_RPAB4 DmmA-like_C Anti-TRAP DZR_2 Zn_ribbon_8 Zn_ribbon_10 MCM_OB HypA Motif Other DBs NCBI-GeneID:  23566891 NCBI-ProteinID:  XP_011391555 UniProt:  A0A0D1DRC0 LinkDB All DBs Position 16:286418..286749 Genome browser AA seq 71 aa AA seqDB search MSYQTRPAGSAPSGGAGLGGMASRNPVMEYICADCAATNEIRPREPIRCRECGHRVMYKK RTKRMLHFEAR NT seq 216 nt NT seq  +upstreamnt  +downstreamnt atgtcgtaccaaacaagaccggcaggatcagcaccgagcggtggtgcaggcttgggtggg atggcgtctcgcaatccggtcatggagtacatttgcgccgactgcgccgccaccaacgag attcgaccccgagaacccatccgttgcagagaatgcggtcaccgtgttatgtacaagaag aggaccaagcgcatgttgcacttcgaagctcgctag

DBGET integrated database retrieval system