Mycosarcoma maydis: UMAG_11523 Help Entry UMAG_11523        CDS       T01021                                  Name (RefSeq) hypothetical protein   KO K00730   dolichyl-diphosphooligosaccharide---protein glycosyltransferase subunit 4 Organism uma  Mycosarcoma maydis Pathway uma00510   N-Glycan biosynthesis uma00513   Various types of N-glycan biosynthesis uma01100   Metabolic pathways uma04141   Protein processing in endoplasmic reticulum Module uma_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:uma00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     UMAG_11523    00513 Various types of N-glycan biosynthesis     UMAG_11523  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     UMAG_11523 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ost4 Motif Other DBs NCBI-GeneID:  23567396 NCBI-ProteinID:  XP_011390565 UniProt:  A0A0D1CMG3 LinkDB All DBs Position 11:282306..282559 Genome browser AA seq 46 aa AA seqDB search MISDVTLSALANWLGSLTMILIVVYHALSVNVKRNQETARKVAAST NT seq 141 nt NT seq  +upstreamnt  +downstreamnt atgattagcgacgtgaccttatccgcgctagccaactggctcggcagtctcaccatgatc ttgatcgtcgtatatcacgcattaagcgtaaatgtcaagaggaatcaagagacagcgaga aaggtcgccgcttcgacatag

DBGET integrated database retrieval system