Mycosarcoma maydis: UMAG_11624 Help Entry UMAG_11624        CDS       T01021                                  Name (RefSeq) hypothetical protein   KO K07342   protein transport protein SEC61 subunit gamma and related proteins Organism uma  Mycosarcoma maydis Pathway uma03060   Protein export uma04141   Protein processing in endoplasmic reticulum uma04145   Phagosome Brite KEGG Orthology (KO) [BR:uma00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     UMAG_11624    04141 Protein processing in endoplasmic reticulum     UMAG_11624  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     UMAG_11624  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:uma04131]     UMAG_11624   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:uma02044]     UMAG_11624 Membrane trafficking [BR:uma04131]  Endoplasmic reticulum (ER) - Golgi transport   Others    SEC61 complex     UMAG_11624 Secretion system [BR:uma02044]  Sec (secretion) system   Eukaryotic Sec-SRP protein    UMAG_11624 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SecE Motif Other DBs NCBI-GeneID:  23567484 NCBI-ProteinID:  XP_011386798 UniProt:  A0A0D1E910 LinkDB All DBs Position 1:2213570..2214589 Genome browser AA seq 70 aa AA seqDB search MSDSIKEFVEIPQNFFREGTHFVNRCTKPNRKEYIQICRAVGLGFVVMGFIGYFVKLIHI PIHSILVGGA NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgtcagactcgatcaaggaattcgtcgagatcccacagaacttcttccgcgaaggaacg cactttgtcaaccgttgcacaaagccgaatcgcaaagaatacatccaaatctgcagagcg gtaggattgggctttgtcgtcatgggcttcatcgggtactttgtcaagcttattcacatt ccaatccactcaatccttgttggtggagcctaa

DBGET integrated database retrieval system