Umezawaea sp. Da 62-37: RM788_07325 Help Entry RM788_07325       CDS       T09853                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ume  Umezawaea sp. Da 62-37 Pathway ume00998   Biosynthesis of various antibiotics ume01100   Metabolic pathways ume01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ume00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     RM788_07325    00074 Mycolic acid biosynthesis     RM788_07325   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     RM788_07325 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  WNV88093 LinkDB All DBs Position 1719632..1719901 Genome browser AA seq 89 aa AA seqDB search MPTLENEIRDFILTTVTKDMNHPIDDAEVGVASPLGSGGIDLDSLSLIELTMRLERRFNV QFPETDIEPLGAMTLGELAADVAGRGATA NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgccgacgctcgagaacgagatccgcgatttcatcctcaccaccgtcaccaaggacatg aaccacccgatcgacgacgccgaggtcggggtggcgagcccgctgggcagcggcgggatc gacctcgactcgctgagcctgatcgagctgaccatgcggctggagcggcgcttcaacgtg cagttcccggagaccgacatcgaaccgctcggcgcgatgacgctgggcgagctggcggcc gacgtggccgggaggggcgcgacagcatga

DBGET integrated database retrieval system