KEGG   Umezawaea sp. Da 62-37: RM788_08040
Entry
RM788_08040       CDS       T09853                                 
Name
(GenBank) TauD/TfdA family dioxygenase
  KO
K03119  taurine dioxygenase [EC:1.14.11.17]
Organism
ume  Umezawaea sp. Da 62-37
Pathway
ume00430  Taurine and hypotaurine metabolism
ume00920  Sulfur metabolism
Brite
KEGG Orthology (KO) [BR:ume00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    RM788_08040
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    RM788_08040
Enzymes [BR:ume01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.17  taurine dioxygenase
     RM788_08040
SSDB
Motif
Pfam: TauD
Other DBs
NCBI-ProteinID: WNV88232
LinkDB
Position
complement(1892202..1893062)
AA seq 286 aa
MTVVSAVEPLTATIGAQLSGFDLSRPQTPAEVADIRAALLQYKLLVFRGQNLTPTAHRDF
AATLGELTPAHPVVPGLDDEHPEIYVLDSGDGGKSPVWHTDVTFMPRPPLGSVLRAVSLP
PVGGDTCWTDLEAAYLALSPHVRSLADRLTALHDGRKDFEDYLNTRLGGEGGTWEGERVT
SLDPSVHPVVRVHPETGRRSLFVSPGFTTRILDVTEAESRALLTLFFSVIGLPEHSVRHR
WSPGDLLVWDNRSTAHYAVDDYGDQHRVMHRVTIRGDAPFGVDQEN
NT seq 861 nt   +upstreamnt  +downstreamnt
atgacagtcgtatccgcggtggaaccgctcacggcgacgatcggcgcgcagctgtccggt
ttcgacctgtccaggccgcagaccccggcggaggtcgccgacatccgcgcggcactgctc
cagtacaagctcctcgtcttccgcggccagaacctgaccccgaccgcccaccgcgacttc
gccgccacgctcggcgaactcacccccgcgcaccccgtcgtgcccggcctcgacgacgag
cacccggagatctacgtgctcgacagcggggacggcggcaagtccccggtctggcacacc
gacgtcaccttcatgccccgcccgccactcggctccgtgctccgcgcggtctcactgccc
ccggtcggcggcgacacctgctggaccgacctggaagccgcttacctggccctctcaccc
catgtccggtcgttggccgaccgcctcaccgcactgcacgacggccgcaaggacttcgag
gactacctcaacacccgcctcggcggcgagggcggcacctgggagggcgaacgcgtcacc
tccctcgatccctccgtccaccccgtcgtccgcgtccaccccgaaaccggccgccgcagc
ctcttcgtcagccccggcttcaccactcgcatcctcgacgtcaccgaagccgaaagccgc
gccctcctgaccctcttcttctccgtcatcggcctccccgaacacagcgtccgccaccgc
tggagccccggcgacctcctcgtgtgggacaaccgcagcacggcccactacgccgtcgac
gactacggcgaccagcaccgcgtcatgcaccgcgtcaccatccgcggcgacgccccgttc
ggcgtcgaccaggagaactga

DBGET integrated database retrieval system