Umezawaea sp. Da 62-37: RM788_50530 Help Entry RM788_50530       CDS       T09853                                  Name (GenBank) acyl carrier protein   KO K16025   methoxymalonate biosynthesis acyl carrier protein Organism ume  Umezawaea sp. Da 62-37 Pathway ume01051   Biosynthesis of ansamycins ume01052   Type I polyketide structures Brite KEGG Orthology (KO) [BR:ume00001]  09100 Metabolism   09109 Metabolism of terpenoids and polyketides    01052 Type I polyketide structures     RM788_50530    01051 Biosynthesis of ansamycins     RM788_50530  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:ume01008]     RM788_50530 Polyketide biosynthesis proteins [BR:ume01008]  Polyketide tailoring proteins   Others    RM788_50530 BRITE hierarchy Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  WNV86270 LinkDB All DBs Position complement(11241225..11241476) Genome browser AA seq 83 aa AA seqDB search MTVSATPDTIERELIDFLETRTKAGWTVTRDLFGEGGLSSLFAMELVVHLEQRYGITITG ANLKLANFRTVGAMVELVVRLRG NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgacggtctcggccaccccggacaccatcgagcgggagttgatcgacttcctggagacg cggacgaaggcggggtggacggtgacccgcgacctgttcggggagggcgggttgtcgtcg ctgttcgcgatggaactggtggtgcacctggagcagcggtacgggatcacgatcaccggc gcgaacctgaagctggcgaacttccggacggtgggcgcgatggtggagctcgtggtccgg ttgcgggggtag

DBGET integrated database retrieval system